Recombinant Nostoc sp. Potassium-transporting ATPase B chain 2(kdpB2)

Code CSB-CF838251NHR
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q8YSD5
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Species Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
Sequence MRSPSRLPHETRDSRQRTPKTDMRGLYQRAIKESFVKLHPKIAVRNPVMFIVWVGTIVTF LVTLNPNLFGTVQANINQQRLLNGLITLILFFTVLFANFAEAVAEGRGKAQADSLKATRS DTIAWKVLPNGSLEKIGSTQLRRGDVIKVVANDMIPGDGEVIQGIGSVDESAITGESAPV LKQPGTDIASSVTGGTRLLSDELIIRITADPGQGFIDRMISLVEGAERSKTPNEIALTVL LAVLTQVFLIVVATMPSFVNYIANFISTAFGAEAANSLRAGASIAILISLLVALIPTTIG GLLSAIGIAGMDRVAQFNVIATSGRAVEACGDINSLVLDKTGTITFGNRMADEFIPVNSY TVEDVARIAKLASLFDETPEGKSIVKLAEKYKILADVNLNQAEGVEFSAKTRMSGTNLPN GKQVRKGAVDAIKGFIRSRGGSIPSDVDVAYERVSLLGGTPLAVCQDNEIFGVIYLKDIV KSGLRERFEQLRRMGVKTIMLTGDNHITASVIAQEAGVDDFIAEATPEDKIDVIRNEQSQ GKLVAMTGDGTNDAPALAQANVGLAMNSGTQAAKEAANMVDLDSDPTKLIDLVTIGKQLL ITRGALTTFSIANDIAKYFAILPTIFGAAGIGALNIMGLKSAQSAIISALIYNALIIPAL IPLALQGVKFRSLTADQLLRRNIFIYGLGGIIAPFIAIKLIDVILPFS
Source in vitro E.coli expression system
Gene Names kdpB2
Protein Names Recommended name: Potassium-transporting ATPase B chain 2 EC= 3.6.3.12 Alternative name(s): ATP phosphohydrolase [potassium-transporting] B chain 2 Potassium-binding and translocating subunit B 2 Potassium-translocating ATPase B cha
Expression Region 1-708
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Part of the high-affinity ATP-driven potassium transport (or Kdp) system, which catalyzes the hydrolysis of ATP coupled with the electrogenic transport of potassium into the cytoplasm. This subunit is responsible for energy coupling to the transport system.
Subcellular Location Cell inner membrane, Multi-pass membrane protein
Protein Families Cation transport ATPase (P-type) (TC 3.A.3) family, Type IA subfamily
Database Links

KEGG: ana:all3153

STRING: 103690.all3153

Related Products

kdpB2 Proteins

kdpB2 Proteins for Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.