Recombinant O-antigen export system permease protein rfbD(rfbD)

Code CSB-CF701108YAQ
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q56902
Storage Buffer Tris-based buffer,50% glycerol
Species Yersinia enterocolitica
Sequence MSLVINDLLKSLHHLPLIFHMAYSDTKARYKRSMLGPLWLTLGAAVGVVGLGLVWSQLLH QERSELIPSLTIGLLLWQFISGCVIESTSTFVKQSQIIRNLQLPFFIHPIQLIVRQSITL AHNLIVLVVVLIIYPQNLGLVSILSIVGFAIVLINLLWISVMLSIIGARFRDVEQIVQAL MPIIFFLTPVLYKAGHAGVNQAIIWLNPFTYFITLVRDPIFGNIPAVFVYQITIGMAIVG WGLTLIIFNRFAPRIAFWI
Source in vitro E.coli expression system
Gene Names rfbD
Protein Names Recommended name: O-antigen export system permease protein rfbD
Expression Region 1-259
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function May form an ATP-driven O-antigen export apparatus, in association with RfbE.
Subcellular Location Cell inner membrane, Multi-pass membrane protein
Protein Families ABC-2 integral membrane protein family

Related Products

rfbD Proteins

rfbD Proteins for Yersinia enterocolitica

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.