Recombinant Ochrobactrum anthropi UPF0283 membrane protein Oant_2119 (Oant_2119)

Code CSB-CF413792ODH
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. A6X0T1
Storage Buffer Tris-based buffer,50% glycerol
Species Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / JCM 21032 / NBRC 15819 / NCTC 12168)
Sequence MTEKTPRKPASFTVSQASNRPEAADEAPRRPRAVRDLDVVVAQPDVFALSEEEAAELEIL DPSFEAPERKGWSLSRILFGALGILVSFAIGIWTEDLIRALFSRADWLGWTALGVAIIAL AAFIAIVVRELVALRRLASVQHLRKDAADAAERDDMAAARKAVDALRSIAAGLPETARGR QLLDGLTDDIIDGRNLIQLAETEILRPLDREARTLILNASKRVSIVTAISPRALVDIGYV IFESARLIRRLSQLYGGRPGTLGFLKLARRVIAHLAVTGTLAMGDSVIQQLVGHGLASRL SAKLGEGVVNGLMTARIGIAAMDVVRPFPFNAEKRPGIGDFIGDLVKINGERPDKKHPGK
Source in vitro E.coli expression system
Gene Names Oant_2119
Protein Names Recommended name: UPF0283 membrane protein Oant_2119
Expression Region 1-360
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Subcellular Location Cell inner membrane, Multi-pass membrane protein
Protein Families UPF0283 family
Database Links

KEGG: oan:Oant_2119

STRING: 439375.Oant_2119

Related Products

Oant_2119 Proteins

Oant_2119 Proteins for Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / JCM 21032 / NBRC 15819 / NCTC 12168)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.