Recombinant Oreochromis niloticus G-protein coupled receptor 54(gpr54)

Code CSB-CF728154OET
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q6BD04
Storage Buffer Tris-based buffer,50% glycerol
Species Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)
Sequence MYSSEELWNSTEQVWINGSGTNFSLGRHEDDEEEEGDKHPFFTDAWLVPLFFSLIMLVGL VGNSLVIYVISKHRQMRTATNFYIANLAATDIIFLVCCVPFTATLYPLPGWIFGNFMCKF VAFLQQVTVQATCITLTAMSGDRCYVTVYPLKSLRHRTPKVAMIVSICIWIGSFVLSTPI LMYQRIEEGYWYGPRQYCMERFPSKTHERAFILYQFIAAYLLPVLTISFCYTLMVKRVGQ PTVEPVDNNYQVNLLSERTISIRSKVSKMVVVIVLLFAICWGPIQIFVLFQSFYPNYQPN YATYKIKTWANCMSYANSSVNPIVYGFMGASFQKSFRKTFPFLFKHKVRDSSMASRTANA EIKFVAAEEGNNNNAVN
Source in vitro E.coli expression system
Gene Names gpr54
Protein Names Recommended name: G-protein coupled receptor 54
Expression Region 1-377
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Receptor speculated to be essential for sexual development. May regulate gonadotropin-releasing hormone (GnRH) secretion. The receptor expression could be a "stop signal" for GnRH1, GnRH2, and GnRH3 neuronal migration, leading to suppression of cell growth and modulation of GnRH secretion, which is important for normal sexual development.
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families G-protein coupled receptor 1 family
Tissue Specificity Expressed in a significantly high percentage (45-60%) of mature GnRH1, GnRH2, and GnRH3 neurons and in immature GnRH3 neurons, which had migrated to the vicinity of their final locations in the brain. Only 5% of immature GnRH1 and GnRH2 neurons have recep
Database Links

STRING: 8128.ENSONIP00000011710

UniGene: Oni.44901

Related Products

gpr54 Proteins

gpr54 Proteins for Oreochromis niloticus (Nile tilapia) (Tilapia nilotica)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.