Recombinant Oryzias latipes Putative violet-sensitive opsin

Code CSB-CF310060OFH
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P87368
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Species Oryzias latipes (Japanese rice fish) (Japanese killifish)
Sequence MGKYFYLYENISKVGPYDGPQYYLAPTWAFYLQAAFMGFVFFVGTPLNFVVLLATAKYKK LRVPLNYILVNITFAGFIFVTFSVSQVFLASVRGYYFFGQTLCALEAAVGAVAGLVTSWS LAVLSFERYLVICKPFGAFKFGSNHALAAVIFTWFMGVVRCPPFFGWSRYIPEGLGCSCG PDWYTNCEEFSCASYSKFLLVTCFICPITIIIFSYSQLLGALRAVAAQQAESASTQKAEK EVSRMIIVMVASFVTCYGPYALTAQYYAYSQDENKDYRLVTIPAFFSKSSCVYNPLIYAF MNKQFNGCIMEMVFGKKMEEASEVSSKTEVSTDS
Source in vitro E.coli expression system
Protein Names Recommended name: Putative violet-sensitive opsin Alternative name(s): KFH-V Violet cone photoreceptor pigment
Expression Region 1-334
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Visual pigments are the light-absorbing molecules that mediate vision. They consist of an apoprotein, opsin, covalently linked to cis-retinal.
Subcellular Location Membrane, Multi-pass membrane protein
Protein Families G-protein coupled receptor 1 family, Opsin subfamily
Tissue Specificity The three color pigments are found in the cone photoreceptor cells.
Database Links

KEGG: ola:100049181

STRING: 8090.ENSORLP00000024036

UniGene: Ola.158

Related Products

Proteins

Proteins for Oryzias latipes (Japanese rice fish) (Japanese killifish)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.