Recombinant Pan troglodytes Olfactory receptor 1E1(OR1E1)

Code CSB-CF890599EQV
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q9TUA9
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Species Pan troglodytes (Chimpanzee)
Sequence MMGQNQTSISDFLLLGLPIQPEQQNLCYALFLAMYLTTLLGNLLIIVLIRLDSHLHTPMY LFLSNLSFSDLCFSSVTIPKLLQNMQNQDPSIPYADCLTQMYFFLLFGDLESFLLVAMAY DRYVAICFPLHYTAIMSPMLCLSVVALSWVLTTFHAMLHTLLMARLCFCADNVIPHFFCD MSALLKLACSDTRVNEWVIFIMGGLILVIPFLLILGSYARIVSSILKVPSSKGICKALST CGSHLSVVSLFYGTVIGLYLCPSANSSTLKDTVMAMIYTVVTPMLNPFIYSLRNRDMKGA LSRVIHQKKTFFSL
Source in vitro E.coli expression system
Gene Names OR1E1
Protein Names Recommended name: Olfactory receptor 1E1
Expression Region 1-314
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Odorant receptor.
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families G-protein coupled receptor 1 family
Database Links

STRING: 9598.ENSPTRP00000014614

UniGene: Ptr.6370

Related Products

OR1E1 Proteins

OR1E1 Proteins for Pan troglodytes (Chimpanzee)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.