Recombinant Pan troglodytes Vomeronasal type-1 receptor 3(VN1R3)

Code CSB-CF800081EQV
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q7YRP3
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Species Pan troglodytes (Chimpanzee)
Sequence MASKDFAIGMILSQIMVGFLGNFFLLYHYSFLHFTRGMLQSTDLTLKHLTIANSLVILSK GIPQTMAAFGLKDSLSDIGCKFVFYVHRVGRAVCTGNACLLSVFQVITISSSEFRWAELK LHAHKYIRSFILVLCWILNTLVNITVPLHVTGKWNSINSTKTNDYGYCSGGSRSRIPHSL HIVLLSSLDVLCLGLMTLASGSMVFILHRLKQQVQHIHGTNLSPRSSPESRVTQSILVLV STLCYFTRSPPSLHMSLFPNPSWWPLNASALITACFPTVSPFVLMSRHPRIPRLGSACCG RNPQFPKLVR
Source in vitro E.coli expression system
Gene Names VN1R3
Protein Names Recommended name: Vomeronasal type-1 receptor 3 Alternative name(s): V1r-like receptor 3
Expression Region 1-310
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Putative pheromone receptor.
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families G-protein coupled receptor 1 family
Database Links

KEGG: ptr:100312580

STRING: 9598.ENSPTRP00000054621

UniGene: Ptr.6304

Related Products

VN1R3 Proteins

VN1R3 Proteins for Pan troglodytes (Chimpanzee)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.