Recombinant Pan troglodytes XK-related protein 5(XKR5)

Code CSB-CF674360EQV
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q49LS3
Storage Buffer Tris-based buffer,50% glycerol
Species Pan troglodytes (Chimpanzee)
Sequence MHAGLLGLSALLQAAEQSARLYTVAYYFTTGRLLWGWLALAVLLPGFLVQALSYLWFRAD GHPGHCSLVMLHLLQLGVWKRHWDAALTALQKEPEAPHRGWLQLQEADLSALRLLEALLQ TGPHLLLQTYVFLASDFTDIVPGVSTLFSWSSLSWALVSYTRFMGFMKPGHLAMPWAALF CQQLWRMGMLGTRVMSLVLFYKAYHFWVFVVAGAHWLVMTFWLVAQQSDIIDSTCHWRLF NLLVGAVYILCYLSFWDSPSRNRMVTFYMVMLLENTILLLLATDFLQGASWTSLQTIAGV LSGFLIGSVSLVIYYSLLHPKSTDIWQGCLRKSCGIAGGDKTERRASPRATDLAGKRTES SGSCQGASYELTILGKPPTPEQVPPEAGLGTQVAVEDSFLSHHHWLWVKLALKTGNMSKI NAAFGDDNPVYCPPAWGLSQQDDLQRKALSAQRELPSSSRHPSTLENSSAFEGVSKAEAD PLETSSYVSFASDQQDEAPTQNPAATQGEGTPKEGADAVSGTQGKGTGGQQRGGEGQQSS TLYFSATAEVATSSQQEGSPATLQTAHSGRRLGKSSPAQPASPHPVGLAPFPATMADISP ILGTGPCRGFCPSAGFPGRTLSISELEEPLEPTRELSHHAAVGVWMSLPQLRTAHEPCLT STPKSESIQTDCSCREQMKQEPSFFI
Source in vitro E.coli expression system
Gene Names XKR5
Protein Names Recommended name: XK-related protein 5
Expression Region 1-686
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Subcellular Location Membrane, Multi-pass membrane protein
Protein Families XK family
Database Links

KEGG: ptr:463970

UniGene: Ptr.6124

Related Products

XKR5 Proteins

XKR5 Proteins for Pan troglodytes (Chimpanzee)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.