Recombinant Pediocin PA-1 transport/processing ATP-binding protein PedD(pedD)

Code CSB-CF339698PEC
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P36497
Storage Buffer Tris-based buffer,50% glycerol
Species Pediococcus acidilactici
Sequence MWTQKWHKYYTAQVDENDCGLAALNMILKYYGSDYMLAHLRQLAKTTADGTTVLGLVKAA KHLNLNAEAVRADMDALTASQLPLPVIVHVFKKNKLPHYYVVYQVTENDLIIGDPDPTVK TTKISKSQFAKEWTQIAIIIAPTVKYKPIKESRHTLIDLVPLLIKQKRLIGLIITAAAIT TLISIAGAYFFQLIIDTYLPHLMTNRLSLVAIGLIVAYAFQAIINYIQSFFTIVLGQRLM IDIVLKYVHHLFDLPMNFFTTRHVGEMTSRFSDASKIIDALGSTTLTLFLDMWILLAVGL FLAYQNINLFLCSLVVVPIYISIVWLFKKTFNRLNQDTMESNAVLNSAIIESLSGIETIK SLTGEATTKKKIDTLFSDLLHKNLAYQKADQGQQAIKAATKLILTIVILWWGTFFVMRHQ LSLGQLLTYNALLAYFLTPLENIINLQPKLQAARVANNRLNEVYLVESEFSKSREITALE QLNGDIEVNHVSFNYGYCSNILEDVSLTIPHHQKITIVGMSGSGKTTLAKLLVGFFEPQE QHGEIQINHHNISDISRTILRQYINYVPQEPFIFSGSVLENLLLGSRPGVTQQMIDQACS FAEIKTDIENLPQGYHTRLSESGFNLSGGQKQRLSIARALLSPAQCFIFDESTSNLDTIT EHKIVSKLLFMKDKTIIFVAHRLNIASQTDKVVVLDHGKIVEQGSHRQLLNYNGYYARLI HNQE
Source in vitro E.coli expression system
Gene Names pedD
Protein Names Recommended name: Pediocin PA-1 transport/processing ATP-binding protein PedD EC= 3.4.22.- Alternative name(s): Pediocin AcH transport ATP-binding protein PapD
Expression Region 1-724
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Involved in the export process of the bacteriocin pediocin PA-1/AcH. Is also essential for pediocin production.
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families ABC transporter superfamily, Pediocin PA-1 exporter (TC 3.A.1.112.2) family

Related Products

pedD Proteins

pedD Proteins for Pediococcus acidilactici

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.