Recombinant Phaeosphaeria nodorum NADH-cytochrome b5 reductase 2(MCR1)

Code CSB-CF609915EUG
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q0U9W5
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Species Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) (Glume blotch fungus) (Parastagonospora nodorum)
Sequence MFARQVIRPARQLQQHVRRYASEAPQSGGSSNGALYVGIGAAGLAGAYIYMRGGKPAAPL SEEANKVAAKVGGASKKAFTGGDQGFISLLLDKSEVVNHNTKKLTFKLPEPDMESGLPVT SAVITKYKGPEMEKPVIRPYTPVSDVDQQGTVDFIVKKYEKGPMSSHMHNMEPGQRLDIK GPIPKYPWSPNKHEHIALIAGGTGITPMWQTARAIFKNPEDKTKVTLVFGNISEEDILLK KEWEHLENTYPQRFRAFYVLDNPPESWQGGKGFITKELLKTVLPEPKEGEKVKIFVCGPP GMYKAISGGKKSPSDQGELDGYLKELGYSKDQVYKF
Source in vitro E.coli expression system
Gene Names MCR1
Protein Names Recommended name: NADH-cytochrome b5 reductase 2 EC= 1.6.2.2 Alternative name(s): Mitochondrial cytochrome b reductase
Expression Region 1-336
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function May mediate the reduction of outer membrane cytochrome b5.
Subcellular Location Mitochondrion outer membrane, Single-pass membrane protein
Protein Families Flavoprotein pyridine nucleotide cytochrome reductase family
Database Links

KEGG: pno:SNOG_11449

STRING: 13684.SNOT_11449

Related Products

MCR1 Proteins

MCR1 Proteins for Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) (Glume blotch fungus) (Parastagonospora nodorum)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.