Recombinant Phaeosphaeria nodorum NADH-cytochrome b5 reductase 2(MCR1)

Code CSB-CF609915EUG
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q0U9W5
Storage Buffer Tris-based buffer,50% glycerol
Species Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) (Glume blotch fungus) (Parastagonospora nodorum)
Sequence MFARQVIRPARQLQQHVRRYASEAPQSGGSSNGALYVGIGAAGLAGAYIYMRGGKPAAPL SEEANKVAAKVGGASKKAFTGGDQGFISLLLDKSEVVNHNTKKLTFKLPEPDMESGLPVT SAVITKYKGPEMEKPVIRPYTPVSDVDQQGTVDFIVKKYEKGPMSSHMHNMEPGQRLDIK GPIPKYPWSPNKHEHIALIAGGTGITPMWQTARAIFKNPEDKTKVTLVFGNISEEDILLK KEWEHLENTYPQRFRAFYVLDNPPESWQGGKGFITKELLKTVLPEPKEGEKVKIFVCGPP GMYKAISGGKKSPSDQGELDGYLKELGYSKDQVYKF
Source in vitro E.coli expression system
Gene Names MCR1
Protein Names Recommended name: NADH-cytochrome b5 reductase 2 EC= 1.6.2.2 Alternative name(s): Mitochondrial cytochrome b reductase
Expression Region 1-336
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function May mediate the reduction of outer membrane cytochrome b5.
Subcellular Location Mitochondrion outer membrane, Single-pass membrane protein
Protein Families Flavoprotein pyridine nucleotide cytochrome reductase family
Database Links

KEGG: pno:SNOG_11449

STRING: 13684.SNOT_11449

Related Products

MCR1 Proteins

MCR1 Proteins for Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) (Glume blotch fungus) (Parastagonospora nodorum)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.