Recombinant Phosphatidylinositol:ceramide inositolphosphotransferase(SLS1)

Code CSB-CF462900TQV
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. B3A0L9
Storage Buffer Tris-based buffer,50% glycerol
Species Trypanosoma brucei brucei
Sequence MISYPFFSLSPPGLVPPPMAVPPVEMYSGSFWNRMRKPLPLRTQVIRFTVVFVIVSFILA VALQITHERMPDPKVTKPLPDLGFELLTKISFLSVVTDVLIAFLSLLSFFTLWKLYLLHR HCVGSGEPELPCNIPGVSRFFLSVWLCKENCRIELRNIHTIAWIRFITSYALLLLFRSLV IVMTSMPTPVDKCQDPPKIENPVKNVILTVLTAGGGSIHCGDLMVSGHTVILTLHLMFHW IYGAMVHWSFRPVVTVVAIFSYYCIVASRSHYTDDVLVAIYLTIATFIAVGHNADGAPWQ LQLFIRWLPCCGANSREVTEDSQPVMVAFKSEAVDELRERDDSAGLSGEVSTNEV
Source in vitro E.coli expression system
Gene Names SLS1
Protein Names Recommended name: Phosphatidylinositol:ceramide inositolphosphotransferase Short name= TbSLS1 EC= 2.7.8.- Alternative name(s): Inositol-phosphorylceramide synthase Short name= IPC synthase Sphingolipid synthase
Expression Region 1-355
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Bidirectional lipid inositolphosphotransferase capable of converting phosphatidylinositol (PI) and ceramide to inositol-phosphorylceramide (IPC) and diacylglycerol (DAG) and vice versa. Direction is dependent on the relative concentrations of DAG and ceramide as phosphoinositol acceptors. Essential for viability of the pathogenic bloodstream stage of this human protozoan parasite and, consequently, can be considered as potential drug target.
Subcellular Location Membrane, Multi-pass membrane protein
Protein Families Sphingomyelin synthase family

Related Products

SLS1 Proteins

SLS1 Proteins for Trypanosoma brucei brucei

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.