Recombinant Photorhabdus luminescens subsp. laumondii Glycerol-3-phosphate acyltransferase(plsY)

Code CSB-CF745539PIJ
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q7N0B7
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Species Photorhabdus luminescens subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Sequence MSAIALGMIIFAYLCGSISSAILICRLAGLPDPRQHGSGNPGATNVLRIGGRSTAAIVLI CDVLKGMIPVWLAYQLYVPPFYLGITAIAACLGHIYPIFFQFKGGKGVATAFGAIAAIGW DLTGLMMGTWLLTILLSGYSSLGAIVSALIAPFYVWWFKPEFTFPVAMLCCLVLLRHHDN IQRLWRGQENRLWNKLKKKKEMTEKEKKRTEKEQRKED
Source in vitro E.coli expression system
Gene Names plsY
Protein Names Recommended name: Glycerol-3-phosphate acyltransferase Alternative name(s): Acyl-PO4 G3P acyltransferase Acyl-phosphate--glycerol-3-phosphate acyltransferase G3P acyltransferase Short name= GPAT EC= 2.3.1.n3 Lysophosphati
Expression Region 1-218
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Catalyzes the transfer of an acyl group from acyl-phosphate (acyl-PO(4)) to glycerol-3-phosphate (G3P) to form lysophosphatidic acid (LPA). This enzyme utilizes acyl-phosphate as fatty acyl donor, but not acyl-CoA or acyl-ACP.
Subcellular Location Cell inner membrane, Multi-pass membrane protein
Protein Families PlsY family
Database Links

KEGG: plu:plu3975

STRING: 243265.plu3975

Related Products

plsY Proteins

plsY Proteins for Photorhabdus luminescens subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.