Recombinant Photorhabdus laumondii subsp. laumondii Maltose/maltodextrin transport system permease protein MalF (malF)

Code CSB-CF762839PIJ
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
malF
Uniprot No.
Alternative Names
malF; plu0459; Maltose/maltodextrin transport system permease protein MalF
Species
Photorhabdus luminescens subsp. laumondii (strain TT01)
Expression Region
1-518
Target Protein Sequence
MSATLEKTSWWQHSALKWLAVSLCVLFTGYLVVLMYSQGEYLFAMVTLVLLGMGIYVFSN RNTYAWRYTYPGVAGMGLFVLFPLICTIAIAFTNYSSINQLTFERAQSVLMSRQYQSGQA LTFKLYPKSDLWVLALSIPSQTKQLVSEPFSLSAMEETTLHVYEQDNLENGEAATLRIIT QNRQALNQLVVVLPDGNRLKMSSLRQFSGVHPQYSLGEDGESLTDNQTGTLYRPNTDTGF YQSVNAEGTWGNETLTPGFTVTIGWKNFLRVIQDEGIQKPFLAIFVWTVVFSLFTVVLTV AVGMVLACIVQWEALKGRAVYRVLLILPYAVPSFISILIFKGLFNQSFGEINLLLNGLFG LKPAWFTDPTMARTMLIVVNAWLGYPYMMILCMGLLKAIPDDLYEASAMDGAGPFQNFFK ITFPLLIKPLTPLMIASFAFNFNNFVLIQLLTLGGPDRIGTTTPAGYTDLLVSYTYRIAF DGSSGQDFGLAAAIATVIFLLVGALAVINLKATRIKFD
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Protein Length
full length protein
Tag Info
N-terminal 10xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Basically, we can dispatch the products out in 1-3 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Part of the ABC transporter complex MalEFGK involved in maltose/maltodextrin import. Probably responsible for the translocation of the substrate across the membrane.
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.
Protein Families
Binding-protein-dependent transport system permease family, MalFG subfamily
Database Links

KEGG: plu:plu0459

STRING: 243265.plu0459

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1