Recombinant Pig Alpha-1,6-mannosyl-glycoprotein 2-beta-N-acetylglucosaminyltransferase(MGAT2)

Code CSB-CF013774PI
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. O19071
Storage Buffer Tris-based buffer,50% glycerol
Species Sus scrofa (Pig)
Sequence MRFRIYKRKVLILTFVVAACGFVLWSSNGRQRKNEALAPPLLDAEPVRGAGARAGDHPAISVGIRRGSNDSAAPLVAAAPQPEVDNLTLRYRSLVYQLNFDQTLRNVDKVSSWVPRELVLVVQVHNRAEYLKLLLDSLRKAQGIDNVLVIFSHDFWSTEINQLIAGVDFCPVLQVFFPFSIQLYPNEFPGTDPRDCPRDLEKNAALKMGCINAEYPDSFGHYREAKFSQTKHHWWWKLHFVWERVKVLRDYAGLILFLEEDHYVAPDFYHVFKKMWNLKQQECPECDVLSLGTYTTVRSFRDVADKVDVKTWKSTEHNMGLALTRDAYQKLIECTDTFCTYDDYNWDWTLQYLTVSCLPKFWKVLVPQVPRIFHAGDCGMHHKKTCRPSTQSAQIESLLNSNKQYMFPETLTISEKLTAALSPPRKNGGWGDIRDHELCKSYRRLQ
Source in vitro E.coli expression system
Gene Names MGAT2
Protein Names Recommended name: Alpha-1,6-mannosyl-glycoprotein 2-beta-N-acetylglucosaminyltransferase EC= 2.4.1.143 Alternative name(s): Beta-1,2-N-acetylglucosaminyltransferase II GlcNAc-T II Short name= GNT-II Mannoside acetylglucosaminyltransferase 2
Expression Region 1-446
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Catalyzes an essential step in the conversion of oligo-mannose to complex N-glycans.
Subcellular Location Golgi apparatus membrane, Single-pass type II membrane protein
Protein Families Glycosyltransferase 16 (GT16) protein family
Database Links

KEGG: ssc:100151745

STRING: 9823.ENSSSCP00000005385

UniGene: Ssc.43963

Related Products

MGAT2 Proteins

MGAT2 Proteins for Sus scrofa (Pig)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.