Recombinant Pig Membrane progestin receptor alpha(PAQR7)

Code CSB-CF772946PI
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q865K8
Storage Buffer Tris-based buffer,50% glycerol
Species Sus scrofa (Pig)
Sequence MATMVAQKLSHLLPSLRQVHPEPQPSVHPEPVFTVDRAEVPPLFWKPYIYVGYRPLHQTW RFYFRTLFQQHNEAVNVWTHLLAALVLLLRLAIFVGTVDFWGDPHALPLFIIVLASFTYL SLSALAHLLQAKSEFWHYSFFFLDYVGVAVYQFGSALAHFYYAIEPAWHAQVQTIFLPMA AFLAWLSCTGSCYNKYIQKPGLLGRTCQEVPSALAYALDISPVAHRILASPEPATDDPAL LYHKCQVVFFLLAAAFFSAFMPERWFPGSCHIFGQGHQLFHVFLVLCTLAQLEAVALDYE ARRPIYEPLHTRWPHNFSGLFLLTVGSSILTAFLLSQLVRRKLDLDRKTQ
Source in vitro E.coli expression system
Gene Names PAQR7
Protein Names Recommended name: Membrane progestin receptor alpha Short name= mPR alpha Alternative name(s): Progestin and adipoQ receptor family member VII
Expression Region 1-350
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Plasma membrane progesterone (P4) receptor coupled to G proteins. Seems to act through a G(i) mediated pathway. May be involved in oocyte maturation. Involved in neurosteroid inhibition of apoptosis. Also binds dehydroepiandrosterone (DHEA), pregnanolone, pregnenolone and allopregnanolone.
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families ADIPOR family
Database Links

KEGG: ssc:396558

STRING: 9823.ENSSSCP00000027353

UniGene: Ssc.16630

Related Products

PAQR7 Proteins

PAQR7 Proteins for Sus scrofa (Pig)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.