Recombinant Pig Membrane progestin receptor beta(PAQR8)

Code CSB-CF768130PI
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q865K9
Storage Buffer Tris-based buffer,50% glycerol
Species Sus scrofa (Pig)
Sequence MTTAILQRLSTLSVSGQHLRRLPKILEDGLPKMPGTVPETDVPQLFREPYIRAGYRPIGH EWRYYFFSLFQKHNEVVNVWTHLLAALAVLLRFWAFVETEGLPWTSAHTLPLLLYVLSSI TYLTFSLLAHLLQSKSELSHYTFYFVDYVGVSVYQYGSALVHFFYASDQAWYERFWLFFL PAAAFCGWLSCTGCCYAKYRYRRPYPVMRKVCQVVPAGLAFILDISPVAHRVALCHLSGC QEQAAWYHTLQIVFFLVSAYFFSCPVPEKYFPGSCDIVGHGHQIFHAFLSICTLSQLEAI LLDYKGRQEIFLHRHSPLSIYAACLSFFFLVACSGATAALLREKIKARLSKKDS
Source in vitro E.coli expression system
Gene Names PAQR8
Protein Names Recommended name: Membrane progestin receptor beta Short name= mPR beta Alternative name(s): Progestin and adipoQ receptor family member VIII
Expression Region 1-354
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Steroid membrane receptor. Binds progesterone. May be involved in oocyte maturation (By similarity).
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families ADIPOR family
Database Links

KEGG: ssc:396559

STRING: 9823.ENSSSCP00000002827

UniGene: Ssc.2599

Related Products

PAQR8 Proteins

PAQR8 Proteins for Sus scrofa (Pig)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.