Recombinant Pig N-acetyllactosaminide alpha-1,3-galactosyltransferase(GGTA1)

Code CSB-CF009400PI
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P50127
Storage Buffer Tris-based buffer,50% glycerol
Species Sus scrofa (Pig)
Sequence MNVKGRVVLSMLLVSTVMVVFWEYINSPEGSLFWIYQSKNPEVGSSAQRGWWFPSWFNNGTHSYHEEEDAIGNEKEQRKEDNRGELPLVDWFNPEKRPEVVTITRWKAPVVWEGTYNRAVLDNYYAKQKITVGLTVFAVGRYIEHYLEEFLISANTYFMVGHKVIFYIMVDDISRMPLIELGPLRSFKVFEIKSEKRWQDISMMRMKTIGEHILAHIQHEVDFLFCMDVDQVFQNNFGVETLGQSVAQLQAWWYKAHPDEFTYERRKESAAYIPFGQGDFYYHAAIFGGTPTQVLNITQECFKGILQDKENDIEAEWHDESHLNKYFLLNKPTKILSPEYCWDYHIGMSVDIRIVKIAWQKKEYNLVRNNI
Source in vitro E.coli expression system
Gene Names GGTA1
Protein Names Recommended name: N-acetyllactosaminide alpha-1,3-galactosyltransferase EC= 2.4.1.87 Alternative name(s): UDP-galactose:beta-D-galactosyl-1,4-N-acetyl-D-glucosaminide alpha-1,3-galactosyltransferase Short name= Galactosyltransferase
Expression Region 1-371
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Synthesizes the galactose-alpha(1,3)-galactose group by catalyzing the transfer of a galactose residue, with an alpha-1,3 linkage, on terminal lactosaminide (Gal-beta-1,4-GlcNAc-R) disaccharide borne by a glycoprotein or a glycolipid. Preferentially glycosylates proteins, can synthesize galactose-alpha(1,3)-galactose on glycoproteins but cannot synthesize the glycolipid called isogloboside 3 (iGb3) (By similarity).
Subcellular Location Golgi apparatus, Golgi stack membrane, Single-pass type II membrane protein
Protein Families Glycosyltransferase 6 family
Database Links

KEGG: ssc:396733

STRING: 9823.ENSSSCP00000005915

UniGene: Ssc.8552

Related Products

GGTA1 Proteins

GGTA1 Proteins for Sus scrofa (Pig)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.