Recombinant Poinsettia latent virus Genome-linked protein precursor(ORF2)

Code CSB-CF705860PEAR
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q5NDN0
Storage Buffer Tris-based buffer,50% glycerol
Species Poinsettia latent virus (isolate Euphorbia pulcherrima/Germany/Siepen/2005) (PnLV) (Poinsettia cryptic virus)
Sequence TTNVRGNLYNDEGFRLSVGEDDKAEHWTDRLMKSITFKTKRWADWAEEESESDDERGKVV PPAKPSNYGEGCPPEHNQYLSDVGDLLTKVIGPEQNEKCVDILMGIMGVDKNEVAPHKEE KAEKGNEAVVSATVKTVKEPTTQCDEDIISEIVKRVVDKMNLKAIEKSVVEILAEKAMTK APRGKRKNSKDTSRPSTPGSYIIPAKRTPDSGPVEKSLNSTGRAKEESPSGARTLPGNIP AWVR
Source in vitro E.coli expression system
Gene Names ORF2
Protein Names Recommended name: Genome-linked protein precursor Cleaved into the following 2 chains: 1. Serine protease EC= 2. 3.4.21.- 3. VPg
Expression Region 417-660
Tag Info N-terminal 10xHis-tagged
Protein Description Full Length of Mature Protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Precursor from which the VPg molecule is probably released at the onset of the RNA synthesis. Essential for virus replication (By similarity).
Subcellular Location Host membrane, Multi-pass membrane protein
Protein Families Peptidase S39B family
Database Links

KEGG: vg:7040107

Related Products

ORF2 Proteins

ORF2 Proteins for Poinsettia latent virus (isolate Euphorbia pulcherrima/Germany/Siepen/2005) (PnLV) (Poinsettia cryptic virus)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.