Recombinant Pongo abelii Presenilins-associated rhomboid-like protein, mitochondrial(PARL)

Code CSB-CF728907PYX
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q5R5H4
Storage Buffer Tris-based buffer,50% glycerol
Species Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)
Sequence FRKAPRKVEPRRSDTGTSGEAYKRSALIPPVEETVFYPSPYPIRSLIKPLFFTVGFTGCA FGSAAIWQYESLKSRVQSYFDGIKADWLDSIRPQKEGDFRKEINKWWNNLSDGQRTVTGI IAANVLVFCLWRVPSLQRTMIRYFTSNPASKVLCSPMLLSTFSHFSLFHMAANMYVLWSF SSSIVNILGQEQFMAVYLSAGVISNFVSYVGKVATGRYGPSLGASGAIMTVLAAVCTKIP EGRLAIIFLPMFTFTAGNALKAIIAMDTAGMILGWKFFDHAAHLGGALFGIWYVTYGHEL IWKNREPLVKIWHEIRTNGPKKGGGSK
Source in vitro E.coli expression system
Gene Names PARL
Protein Names Recommended name: Presenilins-associated rhomboid-like protein, mitochondrial EC= 3.4.21.105 Alternative name(s): Mitochondrial intramembrane-cleaving protease PARL Cleaved into the following chain: 1. P-beta Short name= 2. Pbeta
Expression Region 53-379
Tag Info N-terminal 10xHis-tagged
Protein Description Full Length of Mature Protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Required for the control of apoptosis during postnatal growth. Essential for proteolytic processing of an antiapoptotic form of OPA1 which prevents the release of mitochondrial cytochrome c in response to intrinsic apoptoptic signals (By similarity).
Subcellular Location Mitochondrion inner membrane, Multi-pass membrane protein, SUBCELLULAR LOCATION: P-beta: Nucleus
Protein Families Peptidase S54 family
Database Links

KEGG: pon:100173771

STRING: 9601.ENSPPYP00000024436

UniGene: Pab.7853

Related Products

PARL Proteins

PARL Proteins for Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.