Recombinant Pongo abelii RING finger and transmembrane domain-containing protein 2(RNFT2)

Code CSB-CF722376PYX
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q5RAG4
Storage Buffer Tris-based buffer,50% glycerol
Species Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)
Sequence MWLFTVNQVLRKMQRRHSSNTDNIPPERNRSQALSSEASVDEGGVFESLKAEAASPPALF SGLSGSLPTSSFPSSLVLGSSAGGGDVFIQMPASREEGGGRGEGGAYHHRQPHHHFHHGG HRGGSLLQHVGGDHRGHSEEGGDEQPGTPAPALSELKAVICWLQKGLPFILILLAKLCFQ HKLGIAVCIGMASTFAYANSTLREQVSLKEKRSVLVILWILAFLAGNTLYVLYTFSSQQL YNSLIFLKPNLETLDFFDLLWIVGIADFVLKYITIALKCLIVALPKIILAVKSKGKFYLV IEELSQLFRSLVPIQLWYKYIMGDDSSNSYFLGGVLIVLYSLCKSFDICGRVGGVRKALK LLCTSQNYGVRATGQQCTEAGDICAICQAEFREPLILLCQHVFCEECLCLWLDRERTCPL SRSVAVDTLRCWKDGATSAHFQVY
Source in vitro E.coli expression system
Gene Names RNFT2
Protein Names Recommended name: RING finger and transmembrane domain-containing protein 2
Expression Region 1-444
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Subcellular Location Membrane, Multi-pass membrane protein
Database Links

KEGG: pon:100174460

UniGene: Pab.2881

Related Products

RNFT2 Proteins

RNFT2 Proteins for Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.