Recombinant Populus trichocarpa CASP-like protein POPTRDRAFT_820934 (POPTRDRAFT_820934)

Code CSB-CF496205EXS
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. B9HMP6
Storage Buffer Tris-based buffer,50% glycerol
Species Populus trichocarpa (Western balsam poplar) (Populus balsamifera subsp. trichocarpa)
Sequence MESQNKASLPVMDGLERRVGASQSEGASTCDLLLRVLALVLTLAAAIVLGVDKQTKVVPI KIVDTLPAINLPVSAKWHYLSAFTYSVASNAIACSYAALSLVLAVSGKKGIMSIVIVLDL LMVAMLFSSNGAALAIGLMGYQGNSHVRWTKVCHVFGRFCNQVAVSISLSLLGSILFLLL VGITSLRLHKKSK
Source in vitro E.coli expression system
Gene Names POPTRDRAFT_820934
Protein Names Recommended name: CASP-like protein POPTRDRAFT_820934
Expression Region 1-193
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families Casparian strip membrane proteins (CASP) family
Database Links

KEGG: pop:POPTR_0008s20960g

Related Products

POPTRDRAFT_820934 Proteins

POPTRDRAFT_820934 Proteins for Populus trichocarpa (Western balsam poplar) (Populus balsamifera subsp. trichocarpa)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.