Recombinant Probable CDP-diacylglycerol pyrophosphatase(cdh)

Code CSB-CF350609MVZ
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P63751
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Sequence MPKSRRAVSLSVLIGAVIAALAGALIAVTVPARPNRPEADREALWKIVHDRCEFGYRRTG AYAPCTFVDEQSGTALYKADFDPYQFLLIPLARITGIEDPALRESAGRNYLYDAWAARFL VTARLNNSLPESDVVLTINPKNARTQDQLHIHISCSSPTTSAALRNVDTSEYVGWKQLPI DLGGRRFQGLAVDTKAFESRNLFRDIYLKVTADGKKMENASIAVANVAQDQFLLLLAEGT EDQPVAAETLQDHDCSITKS
Source in vitro E.coli expression system
Protein Names Recommended name: Probable CDP-diacylglycerol pyrophosphatase EC= 3.6.1.26 Alternative name(s): CDP-diacylglycerol phosphatidylhydrolase CDP-diglyceride hydrolase
Expression Region 1-260
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat

Related Products

Proteins

Proteins for

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.