Your Good Partner in Biology Research
Tel : 301-363-4651
Your Good Partner in Biology Research
| Code | CSB-CF352498MVH |
| Product Type | Transmembrane Protein |
| Size | Pls inquiry other sizes |
| Uniprot No. | P63752 |
| Storage Buffer | Tris-based buffer,50% glycerol |
| Species | Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) |
| Sequence | MPKSRRAVSLSVLIGAVIAALAGALIAVTVPARPNRPEADREALWKIVHDRCEFGYRRTG AYAPCTFVDEQSGTALYKADFDPYQFLLIPLARITGIEDPALRESAGRNYLYDAWAARFL VTARLNNSLPESDVVLTINPKNARTQDQLHIHISCSSPTTSAALRNVDTSEYVGWKQLPI DLGGRRFQGLAVDTKAFESRNLFRDIYLKVTADGKKMENASIAVANVAQDQFLLLLAEGT EDQPVAAETLQDHDCSITKS |
| Source | in vitro E.coli expression system |
| Gene Names | cdh |
| Protein Names | Recommended name: Probable CDP-diacylglycerol pyrophosphatase EC= 3.6.1.26 Alternative name(s): CDP-diacylglycerol phosphatidylhydrolase CDP-diglyceride hydrolase |
| Expression Region | 1-260 |
| Tag Info | N-terminal 10xHis-tagged |
| Protein Description | full length protein |
| Storage | Store at -20°C, for extended storage, conserve at -20°C or -80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Still Have Questions? | Leave a Message or Start an on-line Chat |
| Subcellular Location | Cell membrane, Single-pass membrane protein |
| Protein Families | Cdh family |
cdh Proteins for Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
| Code | Product Name | Source |
|---|---|---|
| CSB-YP352498MVH1 CSB-EP352498MVH1 CSB-BP352498MVH1 CSB-MP352498MVH1 |
Recombinant Probable CDP-diacylglycerol pyrophosphatase(cdh) ,partial | Yeast E.coli Baculovirus Mammalian cell |
Recombinant Human Keratin, type I cytoskeletal 10(KRT10)
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Human Protein disulfide-isomerase(P4HB)
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Human Corticosteroid-binding globulin(SERPINA6)
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Human Butyrophilin subfamily 3 member A1(BTN3A1),partial
Express system: Yeast
Species: Homo sapiens (Human)
