Recombinant Probable low-affinity inorganic phosphate transporter(pit)

Code CSB-CF684319MVN
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q50173
Storage Buffer Tris-based buffer,50% glycerol
Species Mycobacterium leprae (strain TN)
Sequence MNINLFLLIIVVITALAFDFTNGFHDTGNAMATSIASGALAPKVAVFFSAILNLVGAFLS TAVAATIAKDLIEADLVTLELVFAGLVGGIVWNLLTWLLGIPSSSSHALIGGIVGARIAA VGGHGVIWSGVISKVIIPAIIAALLAIVVGAVATWLVYAITRSVPAMSTDTRFRRGQIGS ASLVSLAHGTNDAQKTMGVIFLALMSYGTVSKTASTPPLWVIVCCAIAIAAGTYLGGWRI IRTLGKGMVEIKPPQGMAAESSSAAVILLSAHFGYALSTTQVCTGSVLGSGLGKPGGEVR WGVAGRMATAWLVTLPLAGSVGAVTYWIVHLIGGYPGAVIGFSLLVAASVAIYIRSRKVK VDHKNVNENWEGSLTAGLDGSDEHKPHSDVGPKLSATLPRYRSSHHTVGVRNAS
Source in vitro E.coli expression system
Gene Names pit
Protein Names Recommended name: Probable low-affinity inorganic phosphate transporter
Expression Region 1-414
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Low-affinity inorganic phosphate transport.
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families Inorganic phosphate transporter (PiT) (TC 2.A.20) family, Pit subfamily
Database Links

KEGG: mle:ML2260

STRING: 272631.ML2260

Related Products

pit Proteins

pit Proteins for Mycobacterium leprae (strain TN)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.