Recombinant Prochlorococcus marinus Cytochrome b6(petB)

Code CSB-CF669425PAAS
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q46H42
Storage Buffer Tris-based buffer,50% glycerol
Species Prochlorococcus marinus (strain NATL2A)
Sequence MANSSPVYDWFQERLEIQDIADDVTSKYVPPHVNIFYCLGGITLVCFLIQFATGFAMTFY YKPTVTEAYSSVSYLMTDVSFGWLIRSVHRWSASMMVLMLILHVFRVYLTGGFKRPRELT WITGVVMAVITVAFGVTGYSLPWDQVGYWAVKIVSGVPAAIPVIGDFMVELLRGGESVGQ STLTRFYSLHTFVMPWLLAVFMLMHFLMIRKQGISGPL
Source in vitro E.coli expression system
Gene Names petB
Protein Names Recommended name: Cytochrome b6
Expression Region 1-218
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Component of the cytochrome b6-f complex, which mediates electron transfer between photosystem II (PSII) and photosystem I (PSI), cyclic electron flow around PSI, and state transitions.
Subcellular Location Cellular thylakoid membrane, Multi-pass membrane protein
Protein Families Cytochrome b family, PetB subfamily
Database Links

KEGG: pmn:PMN2A_1702

Related Products

petB Proteins

petB Proteins for Prochlorococcus marinus (strain NATL2A)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.