Recombinant Prochlorococcus marinus Cytochrome c biogenesis protein CcsA(ccsA)

Code CSB-CF381393PZH
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. A2C1K1
Storage Buffer Tris-based buffer,50% glycerol
Species Prochlorococcus marinus (strain NATL1A)
Sequence MVDFQLNNFSFDPVVSLGLAAFLFLLIALPISFWSVAGGSDSSKARFLVATSNLFLTSQL ILRWWQSGHFPISNLYESLCFLTWGCTLAQLFVERAWRSPIVSAVATPVSLLSIGFASFV LPENLQSSAPLVPALRSSWLVMHVSVIMCSYAALLIGSILSFGVFLVDGKKQFNIRNSSF GSGSFRQSSELYLDERNENLNSIQPIEFTNAEQLDSLSYRSITAGFLLLTVGLISGAVWA NEAWGSWWSWDPKETWALICWLVYAAYLHTRLTRGWQGKKPAILAIAGFFVIIVCYIGVN LLGVGLHSYGWFFDT
Source in vitro E.coli expression system
Gene Names ccsA
Protein Names Recommended name: Cytochrome c biogenesis protein CcsA
Expression Region 1-315
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Required during biogenesis of c-type cytochromes (cytochrome c6 and cytochrome f) at the step of heme attachment.
Subcellular Location Cellular thylakoid membrane, Multi-pass membrane protein
Protein Families CcmF/CycK/Ccl1/NrfE/CcsA family
Database Links

KEGG: pme:NATL1_08031

STRING: 167555.NATL1_08031

Related Products

ccsA Proteins

ccsA Proteins for Prochlorococcus marinus (strain NATL1A)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.