Recombinant Prochlorococcus marinus Divinyl chlorophyll a/b light-harvesting protein pcbA(pcbA)

Code CSB-CF766776EYP
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q7VCF7
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Species Prochlorococcus marinus (strain SARG / CCMP1375 / SS120)
Sequence MQTYGNPDVTYGWWAGNSGVTNRSGKFIAAHAAHTGLIAFWAGAFTLFELARFDPSVPMG HQPLIALPHLATLGIGFDEAGTFVGGTTVTAIAIVHLVLSMVYGAGGLLHSLTFPGDMQD SEVLQARKFKLEWDNPDNQTFILGHHLIFLGVANIQFVEWARIHGIWDAAAGSIRQVEYN LNLSSIWNHQFDFLTINNLEDVMGGHAFLAFFMITGGAFHIATKQVGEYTKFKGSGLLSA EAILSWSLAGIGWMAIVAAFWCATNTTVYPVDFFGEVLDLKFGIAPYWVDTVDLPNGAHT SRAWLTNVHYFLGFFYIQGHLWHALRAMGFDFKRVSSAVSNIGTASVTLND
Source in vitro E.coli expression system
Gene Names pcbA
Protein Names Recommended name: Divinyl chlorophyll a/b light-harvesting protein pcbA
Expression Region 1-351
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function The antenna complex functions as a light receptor, it captures and delivers excitation energy to photosystems II and I. The Prochlorales pcb genes are not related to higher plant LHCs.
Subcellular Location Cellular thylakoid membrane, Multi-pass membrane protein
Protein Families PsbB/PsbC family, IsiA/Pcb subfamily
Database Links

KEGG: pma:Pro_0783

STRING: 167539.Pro0783

Related Products

pcbA Proteins

pcbA Proteins for Prochlorococcus marinus (strain SARG / CCMP1375 / SS120)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.