Recombinant Prochlorococcus marinus Divinyl chlorophyll a/b light-harvesting protein pcbB(pcbB)

Code CSB-CF672808PAAS
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q46LC1
Storage Buffer Tris-based buffer,50% glycerol
Species Prochlorococcus marinus (strain NATL2A)
Sequence MQTYGNPSVTYDWYAGNSGTANRSGKFIAAHAAHAGLMMFWAGAFTLFELARYDSSVAMG NQNLICLPHLAQLGIGGIENGVITEPYGCTVIAVLHLIFSGVLGAGGILHSTRYDGDLGN YPEGSRPKKFDFEWDDPDKLTFILGHHLIFLGLANIQFVEWAQYHGIWDTALGATRTVSY NLDLGMIWNHQADFLQITSLEDVMGGHAFLAFFQIIGGAFHIITKQFGEYTEFKGKGLLS AEAVLSYSLAGVGYCALVAAFWSSTNTTVYSTEFFGEVLQLKFDFAPYFVDTDPSLAAGA HTARAWLANVHFYLGFFFIQGHLWHALRAMGFDFRRVGKAFDNMENAKITNG
Source in vitro E.coli expression system
Gene Names pcbB
Protein Names Recommended name: Divinyl chlorophyll a/b light-harvesting protein pcbB
Expression Region 1-352
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function The antenna complex functions as a light receptor, it captures and delivers excitation energy to photosystems II and I. The Prochlorales pcb genes are not related to higher plant LHCs.
Subcellular Location Cellular thylakoid membrane, Multi-pass membrane protein
Protein Families PsbB/PsbC family, IsiA/Pcb subfamily
Database Links

KEGG: pmn:PMN2A_0215

Related Products

pcbB Proteins

pcbB Proteins for Prochlorococcus marinus (strain NATL2A)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.