Recombinant Prochlorococcus marinus Divinyl chlorophyll a/b light-harvesting protein pcbG(pcbG)

Code CSB-CF752910EYP
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q7VC50
Storage Buffer Tris-based buffer,50% glycerol
Species Prochlorococcus marinus (strain SARG / CCMP1375 / SS120)
Sequence MQTYGDPNVSYAWYAANAGAVTNKSGRFISSHIAHTGLICFGAGANTLFELARYNPDLPM GSQGLVVLPHLAGLGLGGISNGVFTDTYQLLVVAILHLILSGVYGGGGMLHAFRYEEKLE SYPATSRANKFKFDWNDPDRLTFILGHHLLFLAAGNIQFVEWARVHGIYDPVAGAVRQVE YNLDLGMIWNHQFDFLSISSLEDIMGGHAFLAFFMAAGGVFHILTKNYGEYNSFKGADLL SAEFVLSTSLAGAAYTAFVAALWCASNTTIYPVDLYGDVLQFKLGIAPYWIDTDSSLAAD AHTGRAWLTNVHFFIGFFYLQGHFFHGLRALGFDFKSIGKLFDNLETSETTLN
Source in vitro E.coli expression system
Gene Names pcbG
Protein Names Recommended name: Divinyl chlorophyll a/b light-harvesting protein pcbG
Expression Region 1-353
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function The antenna complex functions as a light receptor, it captures and delivers excitation energy to photosystems I. The Prochlorales pcb genes are not related to higher plant LHCs.
Subcellular Location Cellular thylakoid membrane, Multi-pass membrane protein
Protein Families PsbB/PsbC family, IsiA/Pcb subfamily
Database Links

KEGG: pma:Pro_0892

STRING: 167539.Pro0892

Related Products

pcbG Proteins

pcbG Proteins for Prochlorococcus marinus (strain SARG / CCMP1375 / SS120)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.