Recombinant Prochlorococcus marinus NAD(P)H-quinone oxidoreductase subunit L

Code CSB-CF382632PZF
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. A2CAP6
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Species Prochlorococcus marinus (strain MIT 9303)
Sequence MFLQAVTSPISINSLMVLAAYVLLGGLYLIVVPLLLYSWMNRRWHCMGKFERLSAYGMVF LFFPGLILFAPFLNLRLNGQGEV
Source in vitro E.coli expression system
Gene Names ndhL
Protein Names Recommended name: NAD(P)H-quinone oxidoreductase subunit L EC= 1.6.5.- Alternative name(s): NAD(P)H dehydrogenase I subunit L NDH-1 subunit L NDH-L
Expression Region 1-83
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function NDH-1 shuttles electrons from an unknown electron donor, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory and/or the photosynthetic chain. The immediate electron acceptor for the enzyme in this species is believed to be plastoquinone. Couples the redox reaction to proton translocation, and thus conserves the redox energy in a proton gradient. Cyanobacterial NDH-1 also plays a role in inorganic carbon-concentration.
Subcellular Location Cellular thylakoid membrane, Multi-pass membrane protein
Protein Families Complex I NdhL subunit family
Database Links

KEGG: pmf:P9303_18141

Related Products

ndhL Proteins

ndhL Proteins for Prochlorococcus marinus (strain MIT 9303)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.