Recombinant Prochlorococcus marinus subsp. pastoris Cytochrome b6(petB)

Code CSB-CF766697EYQ
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q7V2X6
Storage Buffer Tris-based buffer,50% glycerol
Species Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / NIES-2087 / MED4)
Sequence MSDSSSVYDWFQERLEIQDITDDVTSKYVPPHVNIFYCLGGITLVCFLIQFATGFAMTFY YKPTVTQAYNSVSYLMTDVSFGWLIRSVHRWSASMMVLMLILHVFRVYLTGGFKRPRELT WVTGVVMAVITVAFGVTGYSLPWDQVGYWAVKIVSGVPAAIPIIGDFMVELLRGGESVGQ STLTRFYSLHTFVLPWSLAVFMLMHFLMIRKQGISGPL
Source in vitro E.coli expression system
Gene Names petB
Protein Names Recommended name: Cytochrome b6
Expression Region 1-218
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Component of the cytochrome b6-f complex, which mediates electron transfer between photosystem II (PSII) and photosystem I (PSI), cyclic electron flow around PSI, and state transitions.
Subcellular Location Cellular thylakoid membrane, Multi-pass membrane protein
Protein Families Cytochrome b family, PetB subfamily
Database Links

KEGG: pmm:PMM0325

STRING: 59919.PMM0325

Related Products

petB Proteins

petB Proteins for Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / NIES-2087 / MED4)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.