Recombinant Prosthecochloris vibrioformis Membrane protein insertase YidC(yidC)

Code CSB-CF393547PZJ
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. A4SH20
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Species Chlorobium phaeovibrioides (strain DSM 265 / 1930) (Prosthecochloris vibrioformis (strain DSM 265))
Sequence MDRNSVTGLALIALIMIVWLQFMSPDKKPVIRESAKKAASVEQVNVPLKPAPVSASDAFG AFASAANGKARKMVVENDLFRATISSKGATLTSLVLKKHLDGALQPVQLVSNRADGALSL LFLTREGRKIDTRDLYFTGGSVDTLHTVTGKESYSVRYRLNVSKNRNILITYSFTGDSYR VGYDVQLNGFSSALAGNEYQLQWDGGLGYTEKNREDEAHNALAGAYLGGSLVKLDAAKDN QAYREEQSGEAKWVAVRNKYFVAALIPAGPTGGFYLDGSKKAGNEFENYLASLKMEVPVS GASLDNSFSLYMGPLDYDIVRAQKAELEKIMDFGWDWLTRPFAEYIILPVFSWMNKFIHN YGLIIIIFAFLIKLVTYPLSLASTKSMKKMAALQPMLKELQDKYKDNPAKLQSELGRIYK EAGVNPLGGCLPVVLQMPLLFAMFYVFRSSIELRQHGFLWAHDLSVPDSILNLGFTIPMY GDHIALMPILMAGTVFVQQKITPTAQTNDQMKIMLYMFPAMMLLFFNNMPSGLGLYYLMF NVFSVAQQFYINSTTTEADMPNVSIAAPARQKKKKSGGGK
Source in vitro E.coli expression system
Gene Names yidC
Protein Names Recommended name: Membrane protein insertase YidC Alternative name(s): Foldase YidC Membrane integrase YidC Membrane protein YidC
Expression Region 1-580
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Required for the insertion and/or proper folding and/or complex formation of integral membrane proteins into the membrane. Involved in integration of membrane proteins that insert both dependently and independently of the Sec translocase complex, as well as at least some lipoproteins. Aids folding of multispanning membrane proteins.
Subcellular Location Cell inner membrane, Multi-pass membrane protein
Protein Families OXA1/ALB3/YidC family, Type 1 subfamily
Database Links

KEGG: pvi:Cvib_1771

STRING: 290318.Cvib_1771

Related Products

yidC Proteins

yidC Proteins for Chlorobium phaeovibrioides (strain DSM 265 / 1930) (Prosthecochloris vibrioformis (strain DSM 265))

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.