Recombinant Pseudomonas aeruginosa Membrane protein insertase YidC(yidC)

Code CSB-CF864152EZX
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q9HT06
Storage Buffer Tris-based buffer,50% glycerol
Species Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Sequence MDIQRSILIVALAVVSYLLVLQWNKDYGQPELPAASASMNTTQGLPDTPSASGTSSDVPT AQSSAAGSEAADKPVAVSDKLIQVKTDVLDLAIDPRGGDIVQLGLLQYPRRLDRPDVPFP LFDNGRERTYLAQSGLTGADGPDASSAGRPLFRSAQSSYQLADGQNELVVDLSFSHDGVN YIKRFTFHRGLKADCSDKEKAQKKIECINENAYQVGVSYLIDNQSGKTWSGNLFAQLKRD GSADPSSTTATGVSTYLGAAVWTPDSPYKKISTKDMDKEQFKESVQGGWVAWLQHYFVTA WVPTKGEQHQVMTRKDGQGNYIVGFTGPTLSVPAGSKVETDLTLYAGPKLQKHLKELSPG LELTVDYGFLWFIAQPIFWLLQHIHSLIGNWGWSIIALTVLIKLAFFPLSAASYRSMARM RAVSPKMQAIKEQHGDDRQKMSQAMMELYKKEKINPLGGCLPILVQMPVFLSLYWVLLES VEMRQAPWLGWITDLSVKDPFFILPIVMGGTMLIQQMLNPTPPDPMQAKVMKLMPIIFTF FFLWFPAGLVLYWVVNNCLSIAQQWYITRKIEAAAKTA
Source in vitro E.coli expression system
Gene Names yidC
Protein Names Recommended name: Membrane protein insertase YidC Alternative name(s): Foldase YidC Membrane integrase YidC Membrane protein YidC
Expression Region 1-578
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Required for the insertion and/or proper folding and/or complex formation of integral membrane proteins into the membrane. Involved in integration of membrane proteins that insert both dependently and independently of the Sec translocase complex, as well as at least some lipoproteins. Aids folding of multispanning membrane proteins.
Subcellular Location Cell inner membrane, Multi-pass membrane protein
Protein Families OXA1/ALB3/YidC family, Type 1 subfamily
Database Links

KEGG: pae:PA5568

STRING: 208964.PA5568

Related Products

yidC Proteins

yidC Proteins for Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.