Recombinant Pseudomonas putida Type 4 prepilin-like proteins leader peptide-processing enzyme(pilD)

Code CSB-CF336199FFZ
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P36642
Storage Buffer Tris-based buffer,50% glycerol
Species Pseudomonas putida (Arthrobacter siderocapsulatus)
Sequence MTLWTFLAMEPAYFITLATVLGLLVGSFLNVVVYRLPIMLERQWQREAHEVLGLPVTEHE RFDLCLPASQCTQCGHRIRAWENLPVLSYLALRGRCSACKQRISVRYPLVEVGCALLSMV VAWRYGASVEALVLLPLTWSLLALSLIDHDQQLLPDAIVLPGLWLGLIVNYFGVWVPLPD AVCGAVVGYLSLWTVYWLFKLVTGKEGMGYGDFKLLALLGAWGGWQVLPLTLLLSSVLGA LVGVYLLRVRNDSMGTAMPFGPYLAIAGWIAVLWGDEIYASNMQLLGF
Source in vitro E.coli expression system
Gene Names pilD
Protein Names Recommended name: Type 4 prepilin-like proteins leader peptide-processing enzyme Alternative name(s): Protein pilD Protein secretion protein XCPA Including the following 2 domains: Leader peptidase EC= 3.4.23.43 Alternative name
Expression Region 1-288
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Cleaves type-4 fimbrial leader sequence and methylates the N-terminal (generally Phe) residue. Processes the pilin precursor during membrane translocation. Required for the assembly of type IV pili and for secretion of most proteins.
Subcellular Location Cell inner membrane, Multi-pass membrane protein
Protein Families Peptidase A24 family

Related Products

pilD Proteins

pilD Proteins for Pseudomonas putida (Arthrobacter siderocapsulatus)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.