Recombinant Pseudomonas syringae pv. phaseolicola Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase(arnC)

Code CSB-CF673087PAAT
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q48HZ2
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Species Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) (Pseudomonas syringae pv. phaseolicola (strain 1448A / Race 6))
Sequence MRPYPIKFVSIVIPVYNERQSLPELLRRTEAACKHLNHRFEIVLVDDGSRDDSAEILQQA AERSASPFVAVILNRNYGQHAAIMAGFEQCKGDVVITLDADLQNPPEEIPRLVALAEQGY DVVGTVRSNRQDSAWRRWPSKIINVAVQRSTGVAMSDYGCMLRAYRRTIVDAMLACRERS TFIPILANSFARHTTEVLVDHAEREHGDSKYSPMRLVNLMFDLITCMTTTPLRLLSIIGF SMALLGVLFAALLIILRLIFGAPWAGDGTFVLFAVLFVFTGGQFIGMGLLGEYLGRMYSD VRARPRFFIEKVVRSSSEVVSESVDSSVTPYMNKVAP
Source in vitro E.coli expression system
Gene Names arnC
Protein Names Recommended name: Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase EC= 2.7.8.30 Alternative name(s): Undecaprenyl-phosphate Ara4FN transferase Short name= Ara4FN transferase
Expression Region 1-337
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Catalyzes the transfer of 4-deoxy-4-formamido-L-arabinose from UDP to undecaprenyl phosphate. The modified arabinose is attached to lipid A and is required for resistance to polymyxin and cationic antimicrobial peptides.
Subcellular Location Cell inner membrane, Multi-pass membrane protein
Protein Families Glycosyltransferase 2 family
Database Links

KEGG: psp:PSPPH_2803

STRING: 264730.PSPPH_2803

Related Products

arnC Proteins

arnC Proteins for Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) (Pseudomonas syringae pv. phaseolicola (strain 1448A / Race 6))

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.