Recombinant Pseudomonas syringae pv. syringae Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase(arnC)

Code CSB-CF709428PWE
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q4ZSZ3
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Species Pseudomonas syringae pv. syringae (strain B728a)
Sequence MKPYPIKFVSIVIPVYNERQSLPELLRRTEAACEQLDHRFEIVLVDDGSRDDSTDILQRA AERADSPFVAVILNRNYGQHAAIMAGFEQCQGDVVITLDADLQNPPEEIPRLVKLAEQGY DVVGTVRSNRQDSAWRRWPSKLINLAVQRSTGVAMNDYGCMLRAYRRTIVDAMLACRERS TFIPILANSFARHTTEVLVDHAEREHGDSKYSPMRLINLMFDLITCMTTTPLRLLSIIGF SMALLGVLFAALLIVLRLIFGASWAGDGMFVLFAVLFVFTGGQFIGMGLLGEYLGRMYSD VRARPRFFIEKIVRSSSPVATDSIDSSVTPYMNKVAP
Source in vitro E.coli expression system
Gene Names arnC
Protein Names Recommended name: Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase EC= 2.7.8.30 Alternative name(s): Undecaprenyl-phosphate Ara4FN transferase Short name= Ara4FN transferase
Expression Region 1-337
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Catalyzes the transfer of 4-deoxy-4-formamido-L-arabinose from UDP to undecaprenyl phosphate. The modified arabinose is attached to lipid A and is required for resistance to polymyxin and cationic antimicrobial peptides.
Subcellular Location Cell inner membrane, Multi-pass membrane protein
Protein Families Glycosyltransferase 2 family
Database Links

KEGG: psb:Psyr_2690

STRING: 205918.Psyr_2690

Related Products

arnC Proteins

arnC Proteins for Pseudomonas syringae pv. syringae (strain B728a)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.