Recombinant Psittacid herpesvirus 1 Envelope glycoprotein I(US7)

Code CSB-CF764915PAAF
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q6UDF5
Storage Buffer Tris-based buffer,50% glycerol
Species Psittacid herpesvirus 1 (isolate Amazon parrot/-/97-0001/1997) (PsHV-1) (Pacheco's disease virus)
Sequence TVIKGLGVSGVFEDTLVVFEKVETEDVGARLVFLGDQRPKNPYGGTVRVLFQPGESGTCS IPLLQVRYSNCTNTSAAVFSGCYRTDTEFSVPRANRGTSPGFVSLRTPTMLDSGDIYVTV HLDHLPRPDAFRIKFVSLYTGNETVRISTKDRAGRDRDSYGGASSPVGGRDSNRRTASRN DDGDLPLALYGPCRPCGKNCKNLREYLLTEESWHEWTSVFAPTTVAPTTTVATTAMRSTT VSFATMTAEVITSTGTVSMEPHNTTTADMVNLTAADPPPSEPVPALNALAIGLVVGGTVA SLVFLSVILGGLISCCARRRSARRLLTRSNSAREMEDLAPSSEDARTSRMSPDVVELSEL VNGAPLSHRNDIGGDDLTSISSASG
Source in vitro E.coli expression system
Gene Names gI
Protein Names Recommended name: Envelope glycoprotein I Short name= gI
Expression Region 24-408
Tag Info N-terminal 10xHis-tagged
Protein Description Full Length of Mature Protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function In epithelial cells, the heterodimer gE/gI is required for the cell-to-cell spread of the virus, by sorting nascent virions to cell junctions. Once the virus reaches the cell junctions, virus particles can spread to adjacent cells extremely rapidly through interactions with cellular receptors that accumulate at these junctions. Implicated in basolateral spread in polarized cells. In neuronal cells, gE/gI is essential for the anterograde spread of the infection throughout the host nervous system. Together with US9, the heterodimer gE/gI is involved in the sorting and transport of viral structural components toward axon tips.
Subcellular Location Virion membrane, Single-pass membrane protein, Host cell membrane, Single-pass type I membrane protein, Host cell junction, Host Golgi apparatus membrane, Single-pass type I membrane protein
Protein Families Alphaherpesvirinae glycoprotein I family
Database Links

KEGG: vg:2656995

Related Products

gI Proteins

gI Proteins for Psittacid herpesvirus 1 (isolate Amazon parrot/-/97-0001/1997) (PsHV-1) (Pacheco's disease virus)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.