Your Good Partner in Biology Research
Tel : 301-363-4651
Your Good Partner in Biology Research
| Code | CSB-CF845643SWW |
| Product Type | Transmembrane Protein |
| Size | Pls inquiry other sizes |
| Uniprot No. | Q8Z8E5 |
| Storage Buffer | Tris-based buffer,50% glycerol |
| Species | Salmonella typhi |
| Sequence | MSRKQLALFEPVLLVQALTDAVKKLSPRAQWRNPVMFVVWAGSVLATLLTLAMVTGQIAG SALFTGVISLWLWFTVLFANFAEALAEGRSKAQANSLKGVKKTAFARRLRAPRHDAQADN VPAAELRKGDIVLVKAGDIIPCDGEVIEGGASVDESAITGESAPVIRESGGDFASVTGGR AVEAAGDVDVLLLDKTGTITLGNRQASDFIPARGVDERTLADAAQLASLADETPEGRSIV ILAKQRFNLRERDVQSLHATFVPFTAQSRMSGINIDNRMIRKGSVDAIRRHVESNGGHFP ADVEQNVENVARLGATPLVVVEGARVLGVIALKDIVKGGIKERFAQLRKMGIKTVMITGD NRLTAAAIAAEAGVDDFLAEATPEAKLALIRQYQAEGRLVAMTGDGTNDAPALAQADVAV AMNSGTQAAKEAGNMVDLDSNPTKLIEVVHIGKQMLMTRGSLTTFSIANDVAKYFAIIPA AFAATYPQLNALNVMGLHSPNSAILSAVIFNALIIIFLIPLALKGVSYKPLSASAMLRRN LWIYGLGGLVVPFIGIKVIDVLLTLLDLA |
| Source | in vitro E.coli expression system |
| Gene Names | kdpB |
| Protein Names | Recommended name: Putative potassium-transporting ATPase B chain EC= 3.6.3.12 Alternative name(s): ATP phosphohydrolase [potassium-transporting] B chain Potassium-binding and translocating subunit B Potassium-translocating ATPase B |
| Expression Region | 1-569 |
| Tag Info | N-terminal 10xHis-tagged |
| Protein Description | full length protein |
| Storage | Store at -20°C, for extended storage, conserve at -20°C or -80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Still Have Questions? | Leave a Message or Start an on-line Chat |
| Function | Part of the high-affinity ATP-driven potassium transport (or Kdp) system, which catalyzes the hydrolysis of ATP coupled with the electrogenic transport of potassium into the cytoplasm. This subunit is responsible for energy coupling to the transport system. |
| Subcellular Location | Cell inner membrane, Multi-pass membrane protein |
| Protein Families | Cation transport ATPase (P-type) (TC 3.A.3) family, Type IA subfamily |
| Database Links |
KEGG: stt:t2170 STRING: 220341.STY0746 |
kdpB Proteins for Salmonella typhi
| Code | Product Name | Source |
|---|---|---|
| CSB-YP845643SWW1 CSB-EP845643SWW1 CSB-BP845643SWW1 CSB-MP845643SWW1 |
Recombinant Putative potassium-transporting ATPase B chain(kdpB) ,partial | Yeast E.coli Baculovirus Mammalian cell |
Recombinant Human Cyclic AMP-dependent transcription factor ATF-3(ATF3)
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Human Pyruvate kinase isozymes R/L(PKLR)
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Human Tryptophan 2,3-dioxygenase(TDO2)
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Rabbit Tropomyosin alpha-1 chain(TPM1)
Express system: Yeast
Species: Oryctolagus cuniculus (Rabbit)
Recombinant Mouse Regenerating islet-derived protein 3-gamma(Reg3g)
Express system: E.coli
Species: Mus musculus (Mouse)
