Recombinant Putative zinc metalloprotease ML1582(ML1582)

Code CSB-CF866425MVN
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q9CBU4
Storage Buffer Tris-based buffer,50% glycerol
Species Mycobacterium leprae (strain TN)
Sequence MMFALGIVLFAIAILISVALHECGHLWVACATGMKVRRYFVGFGPTLWSTRRGETQYGIK AVPLGGFCDIVGMTSVEKLEPDESDRAMYKQATWKRVAVLFAGPAMNFVICLVLIYGIAL VWGLPNLHMPTRAVIGETACVASELDQGKLGNCTGPGPAALAGLRAGDVVVKIGDTTVST FDDMAAVVRKLHGTVPIVFERDGTAITSYVDITPTQRYMSKGKGSQLEPATVGAIGVGAH HLLPTHYGVFSALPATAAFAGDLTVEVGKALVTIPTKLGALVHAIGGGQRDPQTPMSVVG ASIIGGDTVDHGLWVAFWFFLAQLNLILGAINLVPLLPFDGGHIAIAVFERIRNLIRSAR GVVVAAPVNYLKLMPATYVVLVFVVGYVLLTVTADLVNPIRLFQ
Source in vitro E.coli expression system
Gene Names rip1
Protein Names Recommended name: Putative zinc metalloprotease ML1582 EC= 3.4.24.-
Expression Region 1-404
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function A probable intramembrane site-2 protease (S2P) that cleaves type-2 transmembrane proteins within their membrane-spanning domains. Regulated intramembrane proteolysis (RIP) occurs when an extracytoplasmic signal (possibly oxidative stress) triggers a concerted proteolytic cascade to transmit information and elicit cellular responses. The membrane-spanning regulatory substrate protein is first cut extracytoplasmically (site-1 protease, S1P), then within the membrane itself (site-2 protease, S2P, this entry), while cytoplasmic proteases finish degrading the regulatory protein, liberating the effector protein.
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families Peptidase M50B family
Database Links

KEGG: mle:ML1582

STRING: 272631.ML1582

Related Products

rip1 Proteins

rip1 Proteins for Mycobacterium leprae (strain TN)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.