Recombinant Putative zinc metalloprotease XF_1047(XF_1047)

Code CSB-CF868516XBL
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q9PEI1
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Species Xylella fastidiosa (strain 9a5c)
Sequence MGDFFASIWWMIVSFSVLVTFHEFGHYWVARRCGVKVLRFSIGFGTPLWSRRSSSGTEFV IGAIPLGGYVKMLDEREADVTVAERNQAFNRKSVWQRIAIVAAGPLANLLLCMLLLWVLF VIGKQDYSATVGRAEHLAAQAGIHPGDRITAIDGRQVTSWSEASMLLTAAAMDRQNAVLR VIGPYGERSEHTLELSKLKQPFDERHVTALVGINWQFMLQPPIIAKIEPGSIAEGAIKPG DIVLAVDGQQTLSTEDLYNQIQKLGRDGHPGMIEIRRGEERLALELSPRKSAQGVWLLGV KTNPGPVPAFDSQQRYGVLAAVPLAIRETGRMTADSLGMMKRIITGQASAKNISGPISIA KIANASAKRGVGWFIYFLSLLSLSLAIINLFPIPILDGGHLLYYAIELLKGSPLSTRAMA AGQYIGLALLAGLMGLAFYNDLLG
Source in vitro E.coli expression system
Gene Names XF_1047
Protein Names Recommended name: Putative zinc metalloprotease XF_1047 EC= 3.4.24.-
Expression Region 1-444
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Subcellular Location Cell inner membrane, Multi-pass membrane protein
Protein Families Peptidase M50B family
Database Links

KEGG: xfa:XF_1047

STRING: 160492.XF1047

Related Products

XF_1047 Proteins

XF_1047 Proteins for Xylella fastidiosa (strain 9a5c)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.