Recombinant Putative zinc metalloprotease XF_1047(XF_1047)

Code CSB-CF868516XBL
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q9PEI1
Storage Buffer Tris-based buffer,50% glycerol
Species Xylella fastidiosa (strain 9a5c)
Sequence MGDFFASIWWMIVSFSVLVTFHEFGHYWVARRCGVKVLRFSIGFGTPLWSRRSSSGTEFV IGAIPLGGYVKMLDEREADVTVAERNQAFNRKSVWQRIAIVAAGPLANLLLCMLLLWVLF VIGKQDYSATVGRAEHLAAQAGIHPGDRITAIDGRQVTSWSEASMLLTAAAMDRQNAVLR VIGPYGERSEHTLELSKLKQPFDERHVTALVGINWQFMLQPPIIAKIEPGSIAEGAIKPG DIVLAVDGQQTLSTEDLYNQIQKLGRDGHPGMIEIRRGEERLALELSPRKSAQGVWLLGV KTNPGPVPAFDSQQRYGVLAAVPLAIRETGRMTADSLGMMKRIITGQASAKNISGPISIA KIANASAKRGVGWFIYFLSLLSLSLAIINLFPIPILDGGHLLYYAIELLKGSPLSTRAMA AGQYIGLALLAGLMGLAFYNDLLG
Source in vitro E.coli expression system
Gene Names XF_1047
Protein Names Recommended name: Putative zinc metalloprotease XF_1047 EC= 3.4.24.-
Expression Region 1-444
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Subcellular Location Cell inner membrane, Multi-pass membrane protein
Protein Families Peptidase M50B family
Database Links

KEGG: xfa:XF_1047

STRING: 160492.XF1047

Related Products

XF_1047 Proteins

XF_1047 Proteins for Xylella fastidiosa (strain 9a5c)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.