Recombinant Pyrococcus furiosus Digeranylgeranylglyceryl phosphate synthase(PF1963)

Code CSB-CF819614FHW
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q8TZM7
Storage Buffer Tris-based buffer,50% glycerol
Species Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1)
Sequence MEVKGFIEIMRPHNCILAGIVGILGALVAYEGIPDIKTLTLIFWVVYFGCSGGNTANDYF DYEIDKINRPNRPLPRGAMSRRAALYYALLQYAIGSILAYFLNIRAFVFATIAYFLTFLY GWKLKPLPLVGNITVAALTAATPIYGAIGVGRIGLAGYLAICAFLVNVSREIMKDIEDIE GDKALGARTLPIIIGEKKAAIIAAIFGFLTVIASFLPVKVGIGLGYAPIIIVDIIIIKAS IDVLRDPKAASKGQKLLKIATFVAVISFLAGALTKGV
Source in vitro E.coli expression system
Gene Names PF1963
Protein Names Recommended name: Digeranylgeranylglyceryl phosphate synthase Short name= DGGGP synthase Short name= DGGGPS EC= 2.5.1.42 Alternative name(s): (S)-2,3-di-O-geranylgeranylglyceryl phosphate synthase Geranylgeranylglycerol-ph
Expression Region 1-277
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Prenyltransferase that catalyzes the transfer of the geranylgeranyl moiety of geranylgeranyl diphosphate (GGPP) to the C2 hydroxyl of (S)-3-O-geranylgeranylglyceryl phosphate (GGGP). This reaction is the second ether-bond-formation step in the biosynthesis of archaeal membrane lipids.
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families UbiA prenyltransferase family, DGGGP synthase subfamily
Database Links

KEGG: pfu:PF1963

STRING: 186497.PF1963

Related Products

PF1963 Proteins

PF1963 Proteins for Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.