Recombinant Rabbit Ileal sodium/bile acid cotransporter(SLC10A2)

Code CSB-CF630695RB
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q28727
Storage Buffer Tris-based buffer,50% glycerol
Species Oryctolagus cuniculus (Rabbit)
Sequence MSNLTVGCLANATVCEGASCVAPESNFNAILSVVLSTVLTILLALVMFSMGCNVEIKKFL GHIRRPWGIFIGFLCQFGIMPLTGFVLAVAFGIMPIQAVVVLIMGCCPGGTASNILAYWV DGDMDLSVSMTTCSTLLALGMMPLCLYVYTKMWVDSGTIVIPYDNIGTSLVALVVPVSIG MFVNHKWPQKAKIILKVGSIAGAVLIVLIAVVGGILYQSAWIIEPKLWIIGTIFPMAGYS LGFFLARIAGQPWYRCRTVALETGMQNTQLCSTIVQLSFSPEDLTYVFTFPLIYSIFQIA FAAIFLGIYVAYRKCHGKNDAEFPDIKDTKTEPESSFHQMNGGFQPE
Source in vitro E.coli expression system
Gene Names SLC10A2
Protein Names Recommended name: Ileal sodium/bile acid cotransporter Alternative name(s): Apical sodium-dependent bile acid transporter Short name= ASBT Ileal Na(+)/bile acid cotransporter Ileal sodium-dependent bile acid transporter Short na
Expression Region 1-347
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Plays a critical role in the sodium-dependent reabsorption of bile acids from the lumen of the small intestine. Plays a key role in cholesterol metabolism (By similarity).
Subcellular Location Membrane, Multi-pass membrane protein
Protein Families Bile acid:sodium symporter (BASS) (TC 2.A.28) family
Database Links

KEGG: ocu:100009550

STRING: 9986.ENSOCUP00000004722

UniGene: Ocu.3082

Related Products

SLC10A2 Proteins

SLC10A2 Proteins for Oryctolagus cuniculus (Rabbit)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.