Recombinant Rabbit Potassium channel subfamily K member 1(KCNK1)

Code CSB-CF722629RB
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q5UE96
Storage Buffer Tris-based buffer,50% glycerol
Species Oryctolagus cuniculus (Rabbit)
Sequence MLQSLAGSSCVRLVERHRSAWCFGFLVLGYLLYLVFGAVVFSSVELPYEDLLRQELRKLK RRFVEEHECLSEQQLEQFLGRVLEANNYGVSVRSNASGNWNWDFASALFFASTVLSTTGY GHTVPLSDGGKAFCIIYSVIGIPFTLLFLTAVVQRVTVHVTRRPVLYFHVRWGFSKQVVA IVHAVLLGLITVSCFFFIPAAVFSVLEDDWNFLESFYFCFISLSTIGLGDYVPGEGYNQK FRELYKIGITCYLLLGLIAMLVVLETFCELHELKKFRKMFYVKKDKDEDQVHIIEHDQLS FSSITEQAAGMKEDQKQNEPFVATPSSACADGPANH
Source in vitro E.coli expression system
Gene Names KCNK1
Protein Names Recommended name: Potassium channel subfamily K member 1
Expression Region 1-336
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Ion channel that contributes to passive transmembrane potassium transport and to the regulation of the resting membrane potential in brain astrocytes, but also in kidney and in other tissues. Forms dimeric channels through which potassium ions pass in accordance with their electrochemical gradient. The channel is selective for K(+) ions at physiological potassium concentrations and at neutral pH, but becomes permeable to Na(+) at subphysiological K(+) levels and upon acidification of the extracellular medium. The homodimer has very low potassium channel activity, when expressed in heterologous systems, and can function as weakly inward rectifying potassium channel (By similarity). Channel activity is modulated by activation of serotonin receptors (By similarity). Heterodimeric channels containing KCNK1 and KCNK2 have much higher activity, and may represent the predominant form in astrocytes (By similarity). Heterodimeric channels containing KCNK1 and KCNK3 or KCNK9 have much higher activity. Heterodimeric channels formed by KCNK1 and KCNK9 may contribute to halothane-sensitive currents (By similarity). Mediates outward rectifying potassium currents in dentate gyrus granule cells and contributes to the regulation of their resting membrane potential (By similarity). Contributes to the regulation of action potential firing in dentate gyrus granule cells and down-regulates their intrinsic excitability (By similarity). In astrocytes, the heterodimer formed by KCNK1 and KCNK2 is required for rapid glutamate release in response to activation of G-protein coupled receptors, such as F2R and CNR1 (By similarity). Required for normal ion and water transport in the kidney (By similarity). Contributes to the regulation of the resting membrane potential of pancreatic beta cells (By similarity). The low channel activity of homodimeric KCNK1 may be due to sumoylation. The low channel activity may be due to rapid internalization from the cell membrane and retention in recycling endosomes (By similarity).
Subcellular Location Cell membrane, Multi-pass membrane protein, Recycling endosome, Cell junction, synapse, Cytoplasmic vesicle, Perikaryon, Cell projection, dendrite, Cell projection, Apical cell membrane, Multi-pass membrane protein
Protein Families Two pore domain potassium channel (TC 1.A.1.8) family
Tissue Specificity Expressed in renal distal tubules, especially in cortical collecting duct and cortical thick ascending limb, with lower levels in the connecting tubule.
Database Links

KEGG: ocu:100008962

STRING: 9986.ENSOCUP00000013753

UniGene: Ocu.2155

Related Products

KCNK1 Proteins

KCNK1 Proteins for Oryctolagus cuniculus (Rabbit)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.