Recombinant Rat Corticosteroid 11-beta-dehydrogenase isozyme 1 (Hsd11b1)

Code CSB-CF010763RA
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Hsd11b1
Uniprot No.
Alternative Names
Hsd11b1; Hsd11; Corticosteroid 11-beta-dehydrogenase isozyme 1; 11-beta-hydroxysteroid dehydrogenase 1; 11-DH; 11-beta-HSD1
Species
Rattus norvegicus (Rat)
Expression Region
1-288
Target Protein Sequence
MKKYLLPVLVLCLGYYYSTNEEFRPEMLQGKKVIVTGASKGIGREMAYHLSKMGAHVVLTARSEEGLQKVVSRCLELGAASAHYIAGTMEDMAFAERFVVEAGKLLGGLDMLILNHITQTTMSLFHDDIHSVRRSMEVNFLSYVVLSTAALPMLKQSNGSIAIISSMAGKMTQPLIASYSASKFALDGFFSTIRKEHLMTKVNVSITLCVLGFIDTETALKETSGIILSQAAPKEECALEIIKGTVLRKDEVYYDKSSWTPLLLGNPGRRIMEFLSLRSYNRDLFVSN
Protein Length
full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Catalyzes reversibly the conversion of cortisol to the inactive metabolite cortisone. Catalyzes reversibly the conversion of 7-ketocholesterol to 7-beta-hydroxycholesterol. In intact cells, the reaction runs only in one direction, from 7-ketocholesterol to 7-beta-hydroxycholesterol.
Gene References into Functions
  1. These findings indicated that 11beta-HSD1 inhibition can give a potential benefit in reducing obesity and lowering insulin resistance by modulating the insulin-signaling pathway and adipocytokine production. PMID: 27268236
  2. the high-sucrose intake in stressed rats (St + S30 group) reduced the hepatic 11beta-HSD-1 activity, the level of serum corticosterone, and the hepatic triacylglycerol content PMID: 26399510
  3. the availability of H6PDH determines the different direction of 11beta-HSD1 in liver and Leydig cells. PMID: 26528718
  4. The enzyme activity increased 3-4 fold in the adrenal glands throughout the month-long development of alloxan diabetes. PMID: 25430643
  5. Depending on the rat strain, stress stimulates 11HSD1 in the ventral hippocampus. PMID: 24397806
  6. the presented data clearly suggest a role of 11HSD1 in modulation of glucocorticoid feedback of the HPA axis during stress. PMID: 24586766
  7. The 11beta-HSDI enzymatic activity was measured using cortisone as a substrate. PMID: 23979791
  8. Data from knockout mice suggest glucocorticoids metabolized in liver by 11beta-HSD1, rather than circulating glucocorticoids, contribute significantly to development of metabolic syndrome; liver 11beta-HSD1 is key in maintaining metabolic balance. PMID: 23832962
  9. Both 11beta-HSD1 and 11beta-HSD2 are downregulated after uninephrectomy in rats, a constellation considered to induce hypertension. PMID: 22739210
  10. Hyperglycemia induces the variations of 11beta-hydroxysteroid dehydrogenase type 1 and peroxisome proliferator-activated receptor-gamma expression in hippocampus and hypothalamus of diabetic rats PMID: 22792090
  11. Long-term glucocorticoid treatment reduces the 11beta-HSD1 dehydrogenase activity in the bone PMID: 22173247
  12. The expression of hepatic 11beta-HSD1 mRNA was upregulated, while hepatic phosphoenolpyruvate carboxykinase expression was downregulated in calcium-deficient rats. PMID: 22142627
  13. The results presented in this paper suggest that higher 11betaHSD1 gene expression in the white adipose tissue is associated with higher body and adipose tissue mass. PMID: 21879473
  14. Decreased 11beta-HSD1 activity by vitamin A may result in decreased levels of active glucocorticoids in adipose tissue and possibly contribute to visceral fat loss in these obese rats. PMID: 21696642
  15. demonstrated expression of mRNA for 11beta-HSD-1 and 11beta-HSD-2 and protein for 11beta-HSD-1 in rat and human pancreatic islets and insulinoma cells PMID: 21825133
  16. 11beta-HSD1 is enzymatically coupled to 17beta-HSD3 PMID: 21440566
  17. Activation of expression and activity of 11-beta-Hydroxysteroid dehydrogenase type 1 in primary hepatocytes was mediated through levels of glucose, not related to insulin levels so concluding that glucose instead of insulin directly regulates 11b-HSD1. PMID: 21163329
  18. inflammation upregulates the expression of 11HSD1 in mobile lymphoid cells similar to the intraepithelial and lamina propria leukocytes isolated from the colon. PMID: 21513799
  19. Data conclude that dysregulation of 11 beta-HSD1 in WNIN/Ob obese rat model is identical to human obesity, which makes it an excellent model for studying PMID: 21083914
  20. investigation of role of 11betaHSD-1 in adipose tissue in lipid metabolism & development of metabolic syndrome: influence of dietary fatty acids on 11betaHSD-1 gene expression in white adipose tissue PMID: 20932307
  21. This study dememstrated that 11beta-HSD1 levels increase with age in CA3 hippocampus and parietal cortex, correlating with impaired cognitive performance in the water maze. PMID: 20484633
  22. Hepatic 11 beta-hydroxysteroid dehydrogenase 1 has a role in alterations of glucose metabolism produced by acidotic stress in rat PMID: 20358345
  23. Expression of 11-beta-hydroxysteroid dehydrogenase (type II), mostly in mature dentate gyrus granule cells, reversed the effects of high GC levels on granule cell and pyramidal cell excitability, perforant path synaptic plasticity, and spatial memory. PMID: 20130180
  24. 7alpha-hydroxytestosterone regulates the direction of 11 beta-HSD1 activity in rat Leydig cells. PMID: 20016029
  25. Increased adipocyte 11beta HSD-1 activity may be a common molecular etiology for visceral obesity and the metabolic syndrome. PMID: 11739957
  26. Effect of cellular differentiation on 11beta-hydroxysteroid dehydrogenase activity in the intestine PMID: 11755176
  27. renal 11beta-hydroxysteroid dehydrogenase mRNA and protein were decreased to very low levels by estradiol (E2) treatment while 11beta-hydroxysteroid dehydrogenase 2 mRNA and protein were significantly increased by E2 treatment PMID: 12700160
  28. increased HPA activity in the obese Zucker rats and that this seems more influential during stress than in the basal state may be exacerbated by impaired local regeneration of corticosterone by 11betaHSD1. PMID: 12810555
  29. differential expression of 11beta-HSD1 and 11beta-HSD2 throughout the male reproductive tract suggests that these enzymes locally modulate glucocorticoid and mineralocorticoid actions, particularly in the epididymis and penile vasculature. PMID: 12810566
  30. Alveolar type II cells enhance intracellular glucocorticoid availability via 11beta-HSD1. 11beta-HSD1 in alveolar type II cells is thought of as an autocrine amplifier of glucocorticoid action in the lung. PMID: 14599119
  31. 11beta-HSD-1 is expressed in diabetic islets PMID: 14697232
  32. 11beta-HSD1 efficiently catalyzes the first step in the rapid hepatic metabolism of dietary 7KC; upon inhibition of 11beta-HSD1 by CBX, 7KC tended to accumulate in the liver, and plasma 7KC concentration increased PMID: 14973125
  33. Data report on the in vitro oxysterol-metabolizing properties of human and rodent 11beta-hydroxysteroid dehydrogenase. PMID: 15095019
  34. These findings demonstrate 11beta-HSD1 bioactivity in medial vestibular nucleus (MVN) and vestibulocerebellum, but exclude possibility that changes in 11beta-HSD1 activity occur in early period after deafferentation. PMID: 15512857
  35. No association between cardiac hypertrophy and changes of 11HSD1 and 11HSD2 expression. PMID: 15862976
  36. metabolic interconnection between pentose pathway and 11 beta-HSD1 oxo-reductase activities that is dependent on cytosolic NADPH production PMID: 16234247
  37. The results demonstrate the existence of a separate intraluminal pyridine nucleotide pool in the hepatic endoplasmic reticulum and a close cooperation between 11betaHSD1 and H6PDH based on their co-localization. PMID: 16337333
  38. adipocytes are equipped with a functional G6PT-hexose-6-phosphate dehydrogenase-11beta-hydroxysteroid dehydrogenase type 1 system PMID: 17303657
  39. Obese Zucker rats lack a circadian rhythm of 11beta-HSD1 gene expression in the hippocampus. PMID: 17332068
  40. This study showed that sucrose can promote increased 11Beta-hydroxysteroid dehydrogenase-1 (11beta-HSD-1) and Hexose-6-phosphate dehydrogenase (H6PDH) message in mesenteric fat while concomitantly decreasing the enzyme messages in liver. PMID: 18029473
  41. H6PDH was amply expressed in most tissues examined in which 11beta-HSD1 was also expressed, with the notable exception of the renal interstitial cells PMID: 18039793
  42. role in modulating intracellular corticosterone concentrations and effect of glucocorticoid on Leydig cells in response to stress PMID: 18187395
  43. The upregulation of 11beta-HSD1 in ovariectomized rats was most likely due to changes in body composition rather than lack of estrogen PMID: 18379559
  44. Modification of microsomal Hsd11b1 activity by cytosolic compounds: glutathione and hexose phosphoesters is reported. PMID: 18550363
  45. Endogenous 11 beta-HSD1 and 11 beta-HSD2 play significant and distinct roles in modulating the effect of glucocorticoids on eNOS expression. PMID: 18716005
  46. suppression of 11 beta-hydroxysteroid dehydrogenase type 1 expression in the renal medulla attenuates salt-induced hypertension in Dahl salt-sensitive rats. PMID: 18826995
  47. prereceptorial glucocorticoid activation is different in the liver and adipose tissue of the two diabetes rat models might be responsible for the obese and lean phenotypes in type 2 diabetes PMID: 19009916
  48. alteration of 11beta-HSD1 at protein and mRNA level may be related to the abnormality of insulin signal pathway in skeletal muscle, this effect may be mediated by glucocorticoid receptor PMID: 19118409
  49. The dynamic expression patterns of the placental HSD11Bs in late gestation are associated with dramatic shifts in placental corticosterone. PMID: 19208548
  50. 11beta-HSD type I mRNA and its activity was decreased by corticosterone deficiency, whereas the activity and mRNA of aromatase remains unaltered. PMID: 19583995

Show More

Hide All

Subcellular Location
Endoplasmic reticulum membrane; Single-pass type II membrane protein.
Protein Families
Short-chain dehydrogenases/reductases (SDR) family
Tissue Specificity
Liver, kidney, testis and placenta.
Database Links

KEGG: rno:25116

UniGene: Rn.231830

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
webinars: DT3C facilitates antibody internalization X