Recombinant Rat E3 ubiquitin-protein ligase RNF103(Rnf103)

Code CSB-CF875335RA
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q9EPZ8
Storage Buffer Tris-based buffer,50% glycerol
Species Rattus norvegicus (Rat)
Sequence MWLKLFFLLLYFLVLFVLARFFEAIVWYETGIFATQLVDPVALSFKKLKTILECRGLGYS GLPEKKDVRELVEKSGDLMEGELYSALKEEEASESVSSTNFSGEMHFYELVEDTKDGIWL VQVIANDRSPLVGKIHWEKMVKKVSRFGIRTGTFNCSSDPRYCRRRGWVRSTLIMSVPQT STSKGKVMLKEYSGRKIEVEHIFKWITAHAASRIKTIYNVEHLKEEWNKSDQYWVKIYLF ANLDQPPAFFSALSIKFTGRVEFIFVNVENWNNKSYMTDIGIYNMPSYILRTPEGIYRYG NHTGEFISLQAMDSFLRSLQPEVNDLFVLSLVLVNLMAWMDLFITQGATIKRFVVLISTL GTYNSLLIISWLPVLGFLQLPYLDSFYEYSLRLLRYSNTTTLASWVRADWMFYSSHPALF LSTYLGHGLLIDYFEKKRRRSNNDEVNANNLEWLSSLWDWYTSYLFHPIASFQNFPVDSD WDEDPDLFLERLAFPDLWLHPLIPTDYIKNLPMWRFKCLGAQSEEEMSESSQDTENDSDS DNTDTFSSSKDVFEDKQNVHSSPGRTSRCDTEACSCANKCVSSPCERKRRSYGSHNTKED MEPDWLTWPAGTLHCTECVVCLENFENGCLLMGLPCGHVFHQNCIVMWLAGGRHCCPVCR WPSYKKKQPYAQQQPLSNDAPS
Source in vitro E.coli expression system
Gene Names Rnf103
Protein Names Recommended name: E3 ubiquitin-protein ligase RNF103 EC= 6.3.2.- Alternative name(s): Protein ADRG34 RING finger protein 103 Zinc finger protein 103 Short name= Zfp-103
Expression Region 1-682
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Acts as an E2-dependent E3 ubiquitin-protein ligase, probably involved in the ER-associated protein degradation pathway.
Subcellular Location Endoplasmic reticulum membrane, Multi-pass membrane protein
Tissue Specificity Expressed in different tissues including hippocampus, cerebral cortex, heart, kidney, spleen and lung. Expression is increased in hippocampus and frontal cortex after chronic treatment with antidepressants.
Database Links

STRING: 10116.ENSRNOP00000062726

UniGene: Rn.45685

Related Products

Rnf103 Proteins

Rnf103 Proteins for Rattus norvegicus (Rat)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.