Recombinant Rat Endomucin(Emcn)

Code CSB-CF007632RA
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q6AY82
Storage Buffer Tris-based buffer,50% glycerol
Species Rattus norvegicus (Rat)
Sequence ENSKALTETSTTKASATTPDMVSITNKSTGGTPPKGTTNSATPKTPLMPALDSPTTPKHE TTTRGVIKNEVSTIKTTVANPTISNAVSTLSSPQNKTENQSSIRTTEISGTNQLPDDQKP KTTETPSASLTTAKTISQIQDTEDGKITATTSTTPSYSSVILPVVIALIVITVLVFTLVG LYRICWKRDPGTPESGNDQPQSDKESVKLLTVKTISHESGEHSAQGKAKN
Source in vitro E.coli expression system
Gene Names Emcn
Protein Names Recommended name: Endomucin
Expression Region 21-250
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Endothelial sialomucin, also called endomucin or mucin-like sialoglycoprotein, which interferes with the assembly of focal adhesion complexes and inhibits interaction between cells and the extracellular matrix.
Subcellular Location Membrane, Single-pass membrane protein
Database Links

KEGG: rno:295490

STRING: 10116.ENSRNOP00000033031

UniGene: Rn.8542

Related Products

Emcn Proteins

Emcn Proteins for Rattus norvegicus (Rat)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.