Recombinant Rat Epoxide hydrolase 1(Ephx1)

Code CSB-CF007734RA
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P07687
Storage Buffer Tris-based buffer,50% glycerol
Species Rattus norvegicus (Rat)
Sequence MWLELVLASLLGFVIYWFVSRDKEETLPLGDGWWGPGSKPSAKEDESIRPFKVETSDEEIKDLHQRIDRFRASPPLEGSRFHYGFNSNYMKKVVSYWRNEFDWRKQVEILNQYPHFKTKIEGLDIHFIHVKPPQLPSGRTPKPLLMVHGWPGSFYEFYKIIPLLTDPKSHGLSDEHVFEVICPSIPGYGYSEASSKKGLNSVATARIFYKLMTRLGFQKFYIQGGDWGSLICTNMAQMVPNHVKGLHLNMAFISRSFYTMTPLLGQRFGRFLGYTEKDIELLYPYKEKVFYSIMRESGYLHIQATKPDTVGCALNDSPVGLAAYILEKFSTWTKSEYRELEDGGLERKFSLDDLLVNIMIYWTTGTIVSSQRYYKENLGQGIMVHKHEGMKVFVPTGFSAFPSELLHAPEKWVKVKYPKLISYSYMERGGHFAAFEEPKLLAQDIRKFVSLAELQ
Source in vitro E.coli expression system
Gene Names Ephx1
Protein Names Recommended name: Epoxide hydrolase 1 EC= 3.3.2.9 Alternative name(s): Epoxide hydratase Microsomal epoxide hydrolase
Expression Region 1-455
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Biotransformation enzyme that catalyzes the hydrolysis of arene and aliphatic epoxides to less reactive and more water soluble dihydrodiols by the trans addition of water. May play a role in the metabolism of endogenous lipids such as epoxide-containing fatty acids.
Subcellular Location Microsome membrane, Single-pass type III membrane protein, Endoplasmic reticulum membrane, Single-pass type III membrane protein
Protein Families Peptidase S33 family
Database Links

KEGG: rno:25315

STRING: 10116.ENSRNOP00000004780

UniGene: Rn.3603

Related Products

Ephx1 Proteins

Ephx1 Proteins for Rattus norvegicus (Rat)

Ephx1 ELISA Kit

Ephx1 ELISA Kit for Rattus norvegicus (Rat)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.