Recombinant Rat Hereditary hemochromatosis protein homolog(Hfe)

Code CSB-CF010323RA
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. O35799
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Species Rattus norvegicus (Rat)
Sequence QALRPGSHSLRYLFMGASKPDLGLPFFEALGYVDDQLFVSYNHESRRAEPRAPWILGQTSSQLWLQLSQSLKGWDYMFIVDFWTIMGNYNHSKVTKLRVVPESHILQVILGCEVHEDNSTSGFWKYGYDGQDHLEFCPKTLNWSAAEPRAWATKMEWEEHRIRARQSRDYLQRDCPQQLKQVLELQRGVLGQQVPTLVKVTRHWASTGTSLRCQALNFFPQNITMRWLKDSQPLDAKDVNPENVLPNGDGTYQGWLTLAVAPGEETRFSCQVEHPGLDQPLTATWEPSRSQDMIIGIISGITICAIFFVGILILVLRKRKVSGGTMGDYVLTECE
Source in vitro E.coli expression system
Gene Names Hfe
Protein Names Recommended name: Hereditary hemochromatosis protein homolog Alternative name(s): RT1-CAFE
Expression Region 26-360
Tag Info N-terminal 10xHis-tagged
Protein Description Full Length of Mature Protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Binds to transferrin receptor (TFR) and reduces its affinity for iron-loaded transferrin.
Subcellular Location Cell membrane, Single-pass type I membrane protein
Protein Families MHC class I family
Database Links

KEGG: rno:29199

STRING: 10116.ENSRNOP00000022881

UniGene: Rn.42931

Related Products

Hfe Proteins

Hfe Proteins for Rattus norvegicus (Rat)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.