Recombinant Rat Immediate early response 3-interacting protein 1(Ier3ip1)

Code CSB-CF011003RA
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P85007
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Species Rattus norvegicus (Rat)
Sequence MAFTLYSLMQAALLCVNAIAVLHEERFLKNIGWGTDQGIGGFGEEPGIKSQLLNLIRSVR TVMRVPLIIVNSITIVLLLLFG
Source in vitro E.coli expression system
Gene Names Ier3ip1
Protein Names Recommended name: Immediate early response 3-interacting protein 1
Expression Region 1-82
Tag Info N-terminal 10xHis-tagged
Protein Description Full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function May be implicated in the regulation of apoptosis. May be involved in protein transport between endoplasmic reticulum and Golgi apparatus.
Subcellular Location Endoplasmic reticulum membrane, Multi-pass membrane protein
Protein Families YOS1 family
Database Links

UniGene: Rn.7319

Related Products

Ier3ip1 Proteins

Ier3ip1 Proteins for Rattus norvegicus (Rat)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.