Recombinant Rat Lipid phosphate phosphatase-related protein type 4(Lppr4)

Code CSB-CF752626RA
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q7TMB7
Storage Buffer Tris-based buffer,50% glycerol
Species Rattus norvegicus (Rat)
Sequence MQRAGSSGARGECDISGTGRLRLEQAARLGGRAVHTSPTGGLGARQVAGMSAKERPKGKV IKDSVTLLPCFYFVELPILASSVVSLYFLELTDVFKPVHSGFSCYDRSLSMPYIEPTQEA IPFLMLLSLAFAGPAITIMVGEGILYCCLSKRRNGAGLEPNINAGGCNFNSFLRRAVRFV GVHVVGLCSTALITDIIQLATGYQAPYFLTVCKPMYTSLEGSCKENSYIVEEICSGSDLT VINNGKKSFPSQHATLAAFAAVYVSMYFNSTLTDSSKLLKPLLVFTFIICGIICGLTRIT QYKNHPVDVYCGFLIGGGIALYLGLYAVGNFLPSEDSMLQHRDALRSLTDLNQDPSRVLS AKNGSSGDGIAHTEGILNRNHRDASSLTNLKRANADVEIITPRSPMGKESMVTFSNTLPR ANTPSVEDPVRRNASIHASMDSARSKQLLTQWKSKNESRKMSLQVMDSEPEGQSPPRSIE MRSSSEPSRVGVNGDHHVPGNQYLKIQPGTVPGCNNSMPAGPRVSIQSRPGSSQLVHIPE ETQENISTSPKSSSARAKWLKAAEKTVACNRGNNQPRIMQVIAMSKQQGVLQSSPKNAEG STVTCTGSIRYKTLTDHEPSGIVRVEAHPENNRPIIQIPSSTEGEGSGSWKWKAPEKSSL RQTYELNDLNRDSESCESLKDSFGSGDRKRKHIDSNEHHHHGITTIRVTPVEGSEIGSET LSVSSSRDSTLRRKGNIILIPERSNSPENTRNIFYKGTSPTRPYKD
Source in vitro E.coli expression system
Gene Names Plppr4
Protein Names Recommended name: Lipid phosphate phosphatase-related protein type 4 EC= 3.1.3.4 Alternative name(s): Brain-specific phosphatidic acid phosphatase-like protein 1 Plasticity-related gene 1 protein Short name= PRG-1
Expression Region 1-766
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Hydrolyzes lysophosphatidic acid (LPA). Facilitates axonal outgrowth during development and regenerative sprouting. In the outgrowing axons acts as an ecto-enzyme and attenuates phospholipid-induced axon collapse in neurons and facilitates outgrowth in the hippocampus.
Subcellular Location Membrane, Multi-pass membrane protein
Protein Families PA-phosphatase related phosphoesterase family
Tissue Specificity Specifically expressed in neurons.
Database Links

UniGene: Rn.58355

Related Products

Plppr4 Proteins

Plppr4 Proteins for Rattus norvegicus (Rat)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.